Rabbit anti-Human, Mouse PHKA1 Polyclonal Antibody | anti-PHKA1 antibody

PHKA1 Rabbit pAb

Cat. Num. AAA9142095

• Gene Names: PHKA1; PHKA
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Affinity purification
• Synonyms: PHKA1; Polyclonal Antibody; PHKA1 Rabbit pAb; PHKA; anti-PHKA1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: QTGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDDNYDYLESGNWMNDYDSTSHARCGDEVARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPTKLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQADILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEI

• Applicable Applications for anti-PHKA1 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 600-820 of human PHKA1 (NP_001116142.1).
• Cellular Location: Cell membrane, Cytoplasmic side, Lipid-anchor
• Positive Samples: U-87MG, Jurkat, HeLa, Mouse heart
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using PHKA1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Related Product Information for anti-PHKA1 antibody

Background: Phosphorylase kinase is a polymer of 16 subunits, four each of alpha, beta, gamma and delta. The alpha subunit includes the skeletal muscle and hepatic isoforms, and the skeletal muscle isoform is encoded by this gene. The beta subunit is the same in both the muscle and hepatic isoforms, and encoded by one gene. The gamma subunit also includes the skeletal muscle and hepatic isoforms, which are encoded by two different genes. The delta subunit is a calmodulin and can be encoded by three different genes. The gamma subunits contain the active site of the enzyme, whereas the alpha and beta subunits have regulatory functions controlled by phosphorylation. The delta subunit mediates the dependence of the enzyme on calcium concentration. Mutations in this gene cause glycogen storage disease type 9D, also known as X-linked muscle glycogenosis. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. A pseudogene has been found on chromosome 1.

Product Categories/Family for anti-PHKA1 antibody

Endocrine & Metabolism; Carbohydrate metabolism; Research; Neuroscience; Calcium Signaling

NCBI and Uniprot Product Information

• NCBI GI #: 169881275
• NCBI GeneID: 5255
• NCBI Accession #: NP_001116142
• NCBI GenBank Nucleotide #: NM_001122670
• UniProt Accession #: P46020; Q2M3D7; B7ZL05; B7ZL07
• Molecular Weight: 129,388 Da
• NCBI Official Full Name: phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform isoform 2
• NCBI Official Synonym Full Names: phosphorylase kinase, alpha 1 (muscle)
• NCBI Official Symbol: PHKA1
• NCBI Official Synonym Symbols: PHKA
• NCBI Protein Information: phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform; phosphorylase b kinase regulatory subunit alpha skeletal muscle isoform; phosphorylase kinase alpha M subunit; phosphorylase kinase, alpha 1 (muscle), muscle glycogenosis
• UniProt Protein Name: Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
• Protein Family: Phosphorylase b kinase regulatory
• UniProt Gene Name: PHKA1
• UniProt Synonym Gene Names: PHKA; Phosphorylase kinase alpha M subunit
• UniProt Entry Name: KPB1_HUMAN