Rabbit anti-Human PHKA1 Polyclonal Antibody | anti-PHKA1 antibody

PHKA1 Antibody - C-terminal

Cat. Num. AAA3219906

• Gene Names: PHKA1; PHKA
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: PHKA1; Polyclonal Antibody; PHKA1 Antibody - C-terminal; anti-PHKA1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: KQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFY
• Sequence Length: 1151

• Applicable Applications for anti-PHKA1 antibody: Western Blot (WB)
• Immunogen: The immunogen for Anti-PHKA1 antibody is: synthetic peptide directed towards the C-terminal of Human KPB1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KPB1Sample Type: 293T Whole CellAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-PHKA1 antibody

This is a rabbit polyclonal antibody against KPB1. It was validated on Western Blot

Target Description: Phosphorylase kinase is a polymer of 16 subunits, four each of alpha, beta, gamma and delta. The alpha subunit includes the skeletal muscle and hepatic isoforms, and the skeletal muscle isoform is encoded by this gene. The beta subunit is the same in both the muscle and hepatic isoforms, and encoded by one gene. The gamma subunit also includes the skeletal muscle and hepatic isoforms, which are encoded by two different genes. The delta subunit is a calmodulin and can be encoded by three different genes. The gamma subunits contain the active site of the enzyme, whereas the alpha and beta subunits have regulatory functions controlled by phosphorylation. The delta subunit mediates the dependence of the enzyme on calcium concentration. Mutations in this gene cause glycogen storage disease type 9D, also known as X-linked muscle glycogenosis. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. A pseudogene has been found on chromosome 1.

Product Categories/Family for anti-PHKA1 antibody

Polyclonal; Protein Kinases; Disease Related

NCBI and Uniprot Product Information

• NCBI GI #: 169881275
• NCBI GeneID: 5255
• NCBI Accession #: NP_001116142
• NCBI GenBank Nucleotide #: NM_001122670.1
• UniProt Accession #: P46020
• Molecular Weight: 126 kDa
• NCBI Official Full Name: phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform isoform 2
• NCBI Official Synonym Full Names: phosphorylase kinase regulatory subunit alpha 1
• NCBI Official Symbol: PHKA1
• NCBI Official Synonym Symbols: PHKA
• NCBI Protein Information: phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
• UniProt Protein Name: Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
• Protein Family: Phosphorylase b kinase regulatory
• UniProt Gene Name: PHKA1
• UniProt Synonym Gene Names: PHKA; Phosphorylase kinase alpha M subunit
• UniProt Entry Name: KPB1_HUMAN

NCBI Description

Phosphorylase kinase is a polymer of 16 subunits, four each of alpha, beta, gamma and delta. The alpha subunit includes the skeletal muscle and hepatic isoforms, and the skeletal muscle isoform is encoded by this gene. The beta subunit is the same in both the muscle and hepatic isoforms, and encoded by one gene. The gamma subunit also includes the skeletal muscle and hepatic isoforms, which are encoded by two different genes. The delta subunit is a calmodulin and can be encoded by three different genes. The gamma subunits contain the active site of the enzyme, whereas the alpha and beta subunits have regulatory functions controlled by phosphorylation. The delta subunit mediates the dependence of the enzyme on calcium concentration. Mutations in this gene cause glycogen storage disease type 9D, also known as X-linked muscle glycogenosis. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. A pseudogene has been found on chromosome 1.[provided by RefSeq, Feb 2010]