Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA26066_WB6.jpg WB (Western Blot) (FOXA1 monoclonal antibody (M05), clone 3C1. Western Blot analysis of FOXA1 expression in HepG2.)

Mouse FOXA1 Monoclonal Antibody | anti-FOXA1 antibody

FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (APC)

Gene Names
FOXA1; HNF3A; TCF3A
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
FOXA1, Antibody; FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (APC); Forkhead Box A1; HNF3A; MGC33105; TCF3A; anti-FOXA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C1
Specificity
Recognizes FOXA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FOXA1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FOXA1 (NP_004487, 367aa-472aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(FOXA1 monoclonal antibody (M05), clone 3C1. Western Blot analysis of FOXA1 expression in HepG2.)

product-image-AAA26066_WB6.jpg WB (Western Blot) (FOXA1 monoclonal antibody (M05), clone 3C1. Western Blot analysis of FOXA1 expression in HepG2.)

WB (Western Blot)

(FOXA1 monoclonal antibody (M05), clone 3C1 Western Blot analysis of FOXA1 expression in MCF-7.)

product-image-AAA26066_WB5.jpg WB (Western Blot) (FOXA1 monoclonal antibody (M05), clone 3C1 Western Blot analysis of FOXA1 expression in MCF-7.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to FOXA1 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26066_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to FOXA1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to FOXA1 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26066_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to FOXA1 on HeLa cell. [antibody concentration 10 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.5 ug/ml])

product-image-AAA26066_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.5 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.5 ug/ml])

product-image-AAA26066_APP.jpg Application Data (Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.5 ug/ml])
Related Product Information for anti-FOXA1 antibody
Mouse monoclonal antibody raised against a partial recombinant FOXA1.
Product Categories/Family for anti-FOXA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
hepatocyte nuclear factor 3-alpha
NCBI Official Synonym Full Names
forkhead box A1
NCBI Official Symbol
FOXA1
NCBI Official Synonym Symbols
HNF3A; TCF3A
NCBI Protein Information
hepatocyte nuclear factor 3-alpha; HNF-3A; TCF-3A; HNF-3-alpha; forkhead box protein A1; transcription factor 3A
UniProt Protein Name
Hepatocyte nuclear factor 3-alpha
UniProt Gene Name
FOXA1
UniProt Synonym Gene Names
HNF3A; TCF3A; HNF-3-alpha; HNF-3A; TCF-3A
UniProt Entry Name
FOXA1_HUMAN

Similar Products

Product Notes

The FOXA1 foxa1 (Catalog #AAA26066) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FOXA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXA1 foxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.