Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PGLYRP3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit PGLYRP3 Polyclonal Antibody | anti-PGLYRP3 antibody

PGLYRP3 Antibody - N-terminal region

Gene Names
PGLYRP3; PGRPIA; PGRP-Ialpha; PGLYRPIalpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PGLYRP3; Polyclonal Antibody; PGLYRP3 Antibody - N-terminal region; anti-PGLYRP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SVCSQMLRGLQSHSVYTIGWCDVAYNFLVGDDGRVYEGVGWNIQGLHTQG
Sequence Length
341
Applicable Applications for anti-PGLYRP3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PGLYRP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PGLYRP3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-PGLYRP3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-PGLYRP3 antibody
This is a rabbit polyclonal antibody against PGLYRP3. It was validated on Western Blot

Target Description: This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. These proteins are part of the innate immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell walls. This protein binds to murein peptidoglycans of Gram-positive bacteria.
Product Categories/Family for anti-PGLYRP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
peptidoglycan recognition protein 3
NCBI Official Synonym Full Names
peptidoglycan recognition protein 3
NCBI Official Symbol
PGLYRP3
NCBI Official Synonym Symbols
PGRPIA; PGRP-Ialpha; PGLYRPIalpha
NCBI Protein Information
peptidoglycan recognition protein 3
UniProt Protein Name
Peptidoglycan recognition protein 3
UniProt Gene Name
PGLYRP3
UniProt Synonym Gene Names
PGRPIA; PGLYRPIalpha; PGRP-I-alpha
UniProt Entry Name
PGRP3_HUMAN

NCBI Description

This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. These proteins are part of the innate immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell walls. This antimicrobial protein binds to murein peptidoglycans of Gram-positive bacteria. [provided by RefSeq, Oct 2014]

Uniprot Description

PGLYRP3: Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram- negative bacteria, and has bacteriostatic activity towards Gram- negative bacteria. Plays a role in innate immunity. Belongs to the N-acetylmuramoyl-L-alanine amidase 2 family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: membrane; extracellular region; intracellular

Molecular Function: peptidoglycan receptor activity; peptidoglycan binding; zinc ion binding; N-acetylmuramoyl-L-alanine amidase activity

Biological Process: defense response to Gram-positive bacterium; negative regulation of natural killer cell differentiation during immune response; detection of bacterium; negative regulation of interferon-gamma production; innate immune response; pattern recognition receptor signaling pathway; peptidoglycan catabolic process

Research Articles on PGLYRP3

Similar Products

Product Notes

The PGLYRP3 pglyrp3 (Catalog #AAA3217108) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PGLYRP3 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PGLYRP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PGLYRP3 pglyrp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVCSQMLRGL QSHSVYTIGW CDVAYNFLVG DDGRVYEGVG WNIQGLHTQG. It is sometimes possible for the material contained within the vial of "PGLYRP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.