Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PUR4Sample Type: 293T Whole Cell lysatesAntibody Dilution: 0.05ug/ml)

Rabbit PFAS Polyclonal Antibody | anti-PFAS antibody

PFAS antibody - N-terminal region

Gene Names
PFAS; PURL; FGAMS; GATD8; FGARAT; FGAR-AT
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PFAS; Polyclonal Antibody; PFAS antibody - N-terminal region; anti-PFAS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL
Sequence Length
1338
Applicable Applications for anti-PFAS antibody
Western Blot (WB)
Homology
Cow: 83%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PFAS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PUR4Sample Type: 293T Whole Cell lysatesAntibody Dilution: 0.05ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PUR4Sample Type: 293T Whole Cell lysatesAntibody Dilution: 0.05ug/ml)

Western Blot (WB)

(PFAS antibody - N-terminal region validated by WB using 1. Human Skin Fibroblasts (100ug)2. HEK273 cells (20ug)3. HeLa skin cells(20ug) at 1:2,000.)

Western Blot (WB) (PFAS antibody - N-terminal region validated by WB using 1. Human Skin Fibroblasts (100ug)2. HEK273 cells (20ug)3. HeLa skin cells(20ug) at 1:2,000.)

Western Blot (WB)

(WB Suggested Anti-PFAS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysatePFAS is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-PFAS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysatePFAS is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-PFAS antibody
This is a rabbit polyclonal antibody against PFAS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. PFAS catalyzes the fourth step of IMP biosynthesis. Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. The enzyme encoded by this gene catalyzes the fourth step of IMP biosynthesis.
Product Categories/Family for anti-PFAS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
145kDa
NCBI Official Full Name
phosphoribosylformylglycinamidine synthase
NCBI Official Synonym Full Names
phosphoribosylformylglycinamidine synthase
NCBI Official Symbol
PFAS
NCBI Official Synonym Symbols
PURL; FGAMS; GATD8; FGARAT; FGAR-AT
NCBI Protein Information
phosphoribosylformylglycinamidine synthase
UniProt Protein Name
Phosphoribosylformylglycinamidine synthase
UniProt Gene Name
PFAS
UniProt Synonym Gene Names
KIAA0361; FGAM synthase; FGAMS; FGAR amidotransferase; FGAR-AT

NCBI Description

Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. The enzyme encoded by this gene catalyzes the fourth step of IMP biosynthesis. [provided by RefSeq, Jul 2008]

Uniprot Description

PFAS: Phosphoribosylformylglycinamidine synthase involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate

Protein type: EC 6.3.5.3; Ligase; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: cytoplasm; cytosol

Molecular Function: ATP binding; metal ion binding; phosphoribosylformylglycinamidine synthase activity

Biological Process: de novo'IMP biosynthetic process; glutamine metabolic process; purine ribonucleoside monophosphate biosynthetic process; response to drug

Research Articles on PFAS

Similar Products

Product Notes

The PFAS pfas (Catalog #AAA3208100) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PFAS antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's PFAS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PFAS pfas for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESIMSTQESS NPNNVLKFCD NSSAIQGKEV RFLRPEDPTR PSRFQQQQGL. It is sometimes possible for the material contained within the vial of "PFAS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.