Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PF4 rabbit polyclonal antibody. Western Blot analysis of PF4 expression in human spleen.)

Rabbit anti-Human PF4 Polyclonal Antibody | anti-PF4 antibody

PF4 (Platelet Factor 4, PF-4, C-X-C Motif Chemokine 4, Iroplact, Oncostatin-A, CXCL4, SCYB4 MGC138298) (PE)

Gene Names
PF4; PF-4; CXCL4; SCYB4
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PF4; Polyclonal Antibody; PF4 (Platelet Factor 4; PF-4; C-X-C Motif Chemokine 4; Iroplact; Oncostatin-A; CXCL4; SCYB4 MGC138298) (PE); anti-PF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PF4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PF4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PF4, aa1-101 (NP_002610.1).
Immunogen Sequence
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PF4 rabbit polyclonal antibody. Western Blot analysis of PF4 expression in human spleen.)

Western Blot (WB) (PF4 rabbit polyclonal antibody. Western Blot analysis of PF4 expression in human spleen.)

Western Blot (WB)

(PF4 rabbit polyclonal antibody. Western Blot analysis of PF4 expression in A-431.)

Western Blot (WB) (PF4 rabbit polyclonal antibody. Western Blot analysis of PF4 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of PF4 expression in transfected 293T cell line by PF4 polyclonal antibody. Lane 1: PF4 transfected lysate (10.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PF4 expression in transfected 293T cell line by PF4 polyclonal antibody. Lane 1: PF4 transfected lysate (10.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PF4 antibody
Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form.
Product Categories/Family for anti-PF4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,845 Da
NCBI Official Full Name
platelet factor 4
NCBI Official Synonym Full Names
platelet factor 4
NCBI Official Symbol
PF4
NCBI Official Synonym Symbols
PF-4; CXCL4; SCYB4
NCBI Protein Information
platelet factor 4; iroplact; oncostatin-A; C-X-C motif chemokine 4; chemokine (C-X-C motif) ligand 4
UniProt Protein Name
Platelet factor 4
Protein Family
UniProt Gene Name
PF4
UniProt Synonym Gene Names
CXCL4; SCYB4; PF-4
UniProt Entry Name
PLF4_HUMAN

NCBI Description

This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is chemotactic for numerous other cell type and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. [provided by RefSeq, Mar 2012]

Uniprot Description

PF4: Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Apoptosis; Chemokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q12-q21

Cellular Component: extracellular space; extracellular region

Molecular Function: heparin binding; CXCR3 chemokine receptor binding; chemokine activity

Biological Process: negative regulation of cytolysis; platelet activation; cytokine and chemokine mediated signaling pathway; leukocyte chemotaxis; response to lipopolysaccharide; positive regulation of leukocyte chemotaxis; positive regulation of cAMP metabolic process; positive regulation of tumor necrosis factor production; negative regulation of megakaryocyte differentiation; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; platelet degranulation; negative regulation of MHC class II biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; immune response; inflammatory response; positive regulation of macrophage differentiation; blood coagulation

Research Articles on PF4

Similar Products

Product Notes

The PF4 pf4 (Catalog #AAA6389096) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PF4 (Platelet Factor 4, PF-4, C-X-C Motif Chemokine 4, Iroplact, Oncostatin-A, CXCL4, SCYB4 MGC138298) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PF4 pf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.