Rabbit anti-Human PF4 Polyclonal Antibody | anti-PF4 antibody

PF4 (Platelet Factor 4, PF-4, C-X-C Motif Chemokine 4, Iroplact, Oncostatin-A, CXCL4, SCYB4 MGC138298) (HRP)

Cat. Num. AAA6389090

• Gene Names: PF4; PF-4; CXCL4; SCYB4
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PF4; Polyclonal Antibody; PF4 (Platelet Factor 4; PF-4; C-X-C Motif Chemokine 4; Iroplact; Oncostatin-A; CXCL4; SCYB4 MGC138298) (HRP); anti-PF4 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PF4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-PF4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PF4, aa1-101 (NP_002610.1).
• Immunogen Sequence: MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PF4 rabbit polyclonal antibody. Western Blot analysis of PF4 expression in human spleen.)

Western Blot (WB)

(PF4 rabbit polyclonal antibody. Western Blot analysis of PF4 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of PF4 expression in transfected 293T cell line by PF4 polyclonal antibody. Lane 1: PF4 transfected lysate (10.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PF4 antibody

Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form.

Product Categories/Family for anti-PF4 antibody

Antibodies; Coagulation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4505733
• NCBI GeneID: 5196
• NCBI Accession #: NP_002610.1
• NCBI GenBank Nucleotide #: NM_002619
• UniProt Accession #: P02776; Q53X61; Q9UC64; Q9UC65
• Molecular Weight: 10,845 Da
• NCBI Official Full Name: platelet factor 4
• NCBI Official Synonym Full Names: platelet factor 4
• NCBI Official Symbol: PF4
• NCBI Official Synonym Symbols: PF-4; CXCL4; SCYB4
• NCBI Protein Information: platelet factor 4; iroplact; oncostatin-A; C-X-C motif chemokine 4; chemokine (C-X-C motif) ligand 4
• UniProt Protein Name: Platelet factor 4
• Protein Family: Platelet factor
• UniProt Gene Name: PF4
• UniProt Synonym Gene Names: CXCL4; SCYB4; PF-4
• UniProt Entry Name: PLF4_HUMAN

NCBI Description

This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is chemotactic for numerous other cell type and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. [provided by RefSeq, Mar 2012]

Uniprot Description

PF4: Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Apoptosis; Chemokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q12-q21

Cellular Component: extracellular space; extracellular region

Molecular Function: heparin binding; CXCR3 chemokine receptor binding; chemokine activity

Biological Process: negative regulation of cytolysis; platelet activation; cytokine and chemokine mediated signaling pathway; leukocyte chemotaxis; response to lipopolysaccharide; positive regulation of leukocyte chemotaxis; positive regulation of cAMP metabolic process; positive regulation of tumor necrosis factor production; negative regulation of megakaryocyte differentiation; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; platelet degranulation; negative regulation of MHC class II biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; immune response; inflammatory response; positive regulation of macrophage differentiation; blood coagulation