Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of rat liver, using Peroxiredoxin 1/PAG antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Rat Peroxiredoxin 1/PAG Polyclonal Antibody | anti-PAG antibody

Peroxiredoxin 1/PAG Rabbit pAb

Gene Names
PRDX1; PAG; PAGA; PAGB; PRX1; PRXI; MSP23; NKEFA; TDPX2; NKEF-A
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
Peroxiredoxin 1/PAG; Polyclonal Antibody; Peroxiredoxin 1/PAG Rabbit pAb; PRDX1; MSP23; NKEF-A; NKEFA; PAG; PAGA; PAGB; PRX1; PRXI; TDPX2; anti-PAG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Applicable Applications for anti-PAG antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Customer Validation: WB: Rana sylvatica
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human Peroxiredoxin 1/PAG (NP_001189360.1).
Cellular Location
Cytoplasm, Melanosome
Positive Samples
Rat liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of rat liver, using Peroxiredoxin 1/PAG antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of rat liver, using Peroxiredoxin 1/PAG antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-PAG antibody
Background: This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene.
Product Categories/Family for anti-PAG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
199
NCBI Official Full Name
Peroxiredoxin-1
NCBI Official Synonym Full Names
peroxiredoxin 1
NCBI Official Symbol
PRDX1
NCBI Official Synonym Symbols
PAG; PAGA; PAGB; PRX1; PRXI; MSP23; NKEFA; TDPX2; NKEF-A
NCBI Protein Information
peroxiredoxin-1; thioredoxin peroxidase 2; proliferation-associated gene A; natural killer-enhancing factor A; proliferation-associated gene protein; natural killer cell-enhancing factor A; thioredoxin-dependent peroxide reductase 2
UniProt Protein Name
Peroxiredoxin-1
UniProt Gene Name
PRDX1
UniProt Synonym Gene Names
PAGA; PAGB; TDPX2; NKEF-A; PAG
UniProt Entry Name
PRDX1_HUMAN

NCBI Description

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

PRDX1: a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). May have a proliferative effect and play a role in cancer development or progression.

Protein type: Nuclear receptor co-regulator; Oxidoreductase; EC 1.11.1.15

Chromosomal Location of Human Ortholog: 1p34.1

Cellular Component: peroxisomal matrix; extracellular space; mitochondrial matrix; cytoplasm; nucleolus; melanosome; nucleus; cytosol

Molecular Function: protein binding; peroxidase activity; protein homodimerization activity; thioredoxin peroxidase activity; heme binding

Biological Process: cell proliferation; retinal homeostasis; erythrocyte homeostasis; regulation of stress-activated MAPK cascade; response to reactive oxygen species; removal of superoxide radicals; hydrogen peroxide catabolic process; natural killer cell mediated cytotoxicity; skeletal development; regulation of NF-kappaB import into nucleus

Research Articles on PAG

Similar Products

Product Notes

The PAG prdx1 (Catalog #AAA9142310) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Peroxiredoxin 1/PAG Rabbit pAb reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Peroxiredoxin 1/PAG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000 Customer Validation: WB: Rana sylvatica. Researchers should empirically determine the suitability of the PAG prdx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSGNAKIGH PAPNFKATAV MPDGQFKDIS LSDYKGKYVV FFFYPLDFTF VCPTEIIAFS DRAEEFKKLN CQVIGASVDS HFCHLAWVNT PKKQGGLGPM NIPLVSDPKR TIAQDYGVLK ADEGISFRGL FIIDDKGILR QITVNDLPVG RSVDETLRLV QAFQFTDKHG EVCPAGWKPG SDTIKPDVQK SKEYFSKQK. It is sometimes possible for the material contained within the vial of "Peroxiredoxin 1/PAG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.