Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MYLK3Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit MYLK3 Polyclonal Antibody | anti-MYLK3 antibody

MYLK3 Antibody - C-terminal region

Gene Names
MYLK3; MLCK; MLCK2; caMLCK
Reactivity
Cow, Dog, Guinea Pig, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MYLK3; Polyclonal Antibody; MYLK3 Antibody - C-terminal region; anti-MYLK3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWK
Sequence Length
819
Applicable Applications for anti-MYLK3 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYLK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MYLK3Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MYLK3Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MYLK3 antibody
This is a rabbit polyclonal antibody against MYLK3. It was validated on Western Blot

Target Description: Phosphorylation of cardiac myosin heavy chains and light chains by a kinase, such as MYLK3, potentiates the force and rate of cross-bridge recruitment in cardiac myocytes.
Product Categories/Family for anti-MYLK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
myosin light chain kinase 3 isoform 1
NCBI Official Synonym Full Names
myosin light chain kinase 3
NCBI Official Symbol
MYLK3
NCBI Official Synonym Symbols
MLCK; MLCK2; caMLCK
NCBI Protein Information
myosin light chain kinase 3
UniProt Protein Name
Myosin light chain kinase 3
Protein Family
UniProt Gene Name
MYLK3
UniProt Synonym Gene Names
MLCK; Cardiac-MLCK

NCBI Description

Phosphorylation of cardiac myosin heavy chains (see MYH7B, MIM 609928) and light chains (see MYL2, MIM 160781) by a kinase, such as MYLK3, potentiates the force and rate of cross-bridge recruitment in cardiac myocytes (Chan et al., 2008 [PubMed 18202317]).[supplied by OMIM, Jul 2008]

Uniprot Description

caMLCK: Kinase that phosphorylates MYL2 in vitro. Promotes sarcomere formation in cardiomyocytes and increases cardiomyocyte contractility. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: CAMK group; EC 2.7.11.18; Kinase, protein; MLCK family; Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor)

Chromosomal Location of Human Ortholog: 16q11.2

Cellular Component: actin cytoskeleton; cytoplasm; cytosol; intracellular

Molecular Function: ATP binding; calmodulin-dependent protein kinase activity; myosin light chain kinase activity

Biological Process: cardiac myofibril assembly; cellular response to interleukin-1; peptidyl-serine phosphorylation; peptidyl-threonine phosphorylation; protein amino acid phosphorylation; regulation of vascular permeability during acute inflammatory response; sarcomere organization; sarcomerogenesis

Research Articles on MYLK3

Similar Products

Product Notes

The MYLK3 mylk3 (Catalog #AAA3218091) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYLK3 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYLK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYLK3 mylk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVKEKSCRMS ATQCLKHEWL NNLPAKASRS KTRLKSQLLL QKYIAQRKWK. It is sometimes possible for the material contained within the vial of "MYLK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.