Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PEPDSample Tissue: 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PEPD Polyclonal Antibody | anti-PEPD antibody

PEPD Antibody - middle region

Gene Names
PEPD; PROLIDASE
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PEPD; Polyclonal Antibody; PEPD Antibody - middle region; anti-PEPD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: CICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSF
Sequence Length
493
Applicable Applications for anti-PEPD antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PEPD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PEPDSample Tissue: 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PEPDSample Tissue: 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PEPD antibody
This gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rate limiting for the production of collagen. Mutations in this gene result in prolidase deficiency, which is characterized by the excretion of large amount of di- and tri-peptides containing proline. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PEPD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 kDa
NCBI Official Full Name
xaa-Pro dipeptidase isoform 1
NCBI Official Synonym Full Names
peptidase D
NCBI Official Symbol
PEPD
NCBI Official Synonym Symbols
PROLIDASE
NCBI Protein Information
xaa-Pro dipeptidase
UniProt Protein Name
Xaa-Pro dipeptidase
Protein Family
UniProt Gene Name
PEPD
UniProt Synonym Gene Names
PRD; X-Pro dipeptidase; Prolidase
UniProt Entry Name
PEPD_HUMAN

NCBI Description

This gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rate limiting for the production of collagen. Mutations in this gene result in prolidase deficiency, which is characterized by the excretion of large amount of di- and tri-peptides containing proline. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]

Uniprot Description

peptidase D: Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. Plays an important role in collagen metabolism because the high level of iminoacids in collagen. Defects in PEPD are a cause of prolidase deficiency (PD). Prolidase deficiency is an autosomal recessive disorder associated with iminodipeptiduria. The clinical phenotype includes skin ulcers, mental retardation, recurrent infections, and a characteristic facies. These features, however are incompletely penetrant and highly variable in both age of onset and severity. There is a tight linkage between the polymorphisms of prolidase and the myotonic dystrophy trait. Belongs to the peptidase M24B family. Eukaryotic-type prolidase subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.13.9; Protease

Chromosomal Location of Human Ortholog: 19q13.11

Molecular Function: metallocarboxypeptidase activity; protein binding

Biological Process: amino acid metabolic process

Disease: Prolidase Deficiency

Research Articles on PEPD

Similar Products

Product Notes

The PEPD pepd (Catalog #AAA3219809) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PEPD Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PEPD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PEPD pepd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CICGSGENSA VLHYGHAGAP NDRTIQNGDM CLFDMGGEYY CFASDITCSF. It is sometimes possible for the material contained within the vial of "PEPD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.