Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PEG3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A204 cell lysatePEG3 is strongly supported by BioGPS gene expression data to be expressed in Human A204 cells)

Rabbit PEG3 Polyclonal Antibody | anti-PEG3 antibody

PEG3 antibody - C-terminal region

Gene Names
PEG3; PW1; ZNF904; ZSCAN24; ZKSCAN22
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PEG3; Polyclonal Antibody; PEG3 antibody - C-terminal region; anti-PEG3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG
Sequence Length
1588
Applicable Applications for anti-PEG3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PEG3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PEG3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A204 cell lysatePEG3 is strongly supported by BioGPS gene expression data to be expressed in Human A204 cells)

Western Blot (WB) (WB Suggested Anti-PEG3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A204 cell lysatePEG3 is strongly supported by BioGPS gene expression data to be expressed in Human A204 cells)
Related Product Information for anti-PEG3 antibody
This is a rabbit polyclonal antibody against PEG3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PEG3 induces apoptosis in cooperation with SIAH1A and acts as a mediator between TP53/p53 and BAX in a neuronal death pathway that is activated by DNA damage. PEG3 acts synergistically with TRAF2 and inhibits TNF induced apoptosis through activation of NF-kappa-B. PEG3 also possesses a tumor suppressing activity in glioma cells.
Product Categories/Family for anti-PEG3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
181kDa
NCBI Official Full Name
paternally-expressed gene 3 protein isoform 1
NCBI Official Synonym Full Names
paternally expressed 3
NCBI Official Symbol
PEG3
NCBI Official Synonym Symbols
PW1; ZNF904; ZSCAN24; ZKSCAN22
NCBI Protein Information
paternally-expressed gene 3 protein
UniProt Protein Name
Paternally-expressed gene 3 protein
UniProt Gene Name
PEG3
UniProt Synonym Gene Names
KIAA0287; ZSCAN24
UniProt Entry Name
PEG3_HUMAN

NCBI Description

In human, ZIM2 and PEG3 are treated as two distinct genes though they share multiple 5' exons and a common promoter and both genes are paternally expressed (PMID:15203203). Alternative splicing events connect their shared 5' exons either with the remaining 4 exons unique to ZIM2, or with the remaining 2 exons unique to PEG3. In contrast, in other mammals ZIM2 does not undergo imprinting and, in mouse, cow, and likely other mammals as well, the ZIM2 and PEG3 genes do not share exons. Human PEG3 protein belongs to the Kruppel C2H2-type zinc finger protein family. PEG3 may play a role in cell proliferation and p53-mediated apoptosis. PEG3 has also shown tumor suppressor activity and tumorigenesis in glioma and ovarian cells. Alternative splicing of this PEG3 gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Sep 2009]

Uniprot Description

PEG3: Induces apoptosis in cooperation with SIAH1A. Acts as a mediator between p53/TP53 and BAX in a neuronal death pathway that is activated by DNA damage. Acts synergistically with TRAF2 and inhibits TNF induced apoptosis through activation of NF-kappa-B. Possesses a tumor suppressing activity in glioma cells. Belongs to the krueppel C2H2-type zinc-finger protein family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: nucleic acid binding; metal ion binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; in utero embryonic development; apoptosis; multicellular organism growth

Research Articles on PEG3

Similar Products

Product Notes

The PEG3 peg3 (Catalog #AAA3204259) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PEG3 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PEG3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PEG3 peg3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGECSGYIER ASTSTGGANQ ADEKYFKCDV CGQLFNDRLS LARHQNTHTG. It is sometimes possible for the material contained within the vial of "PEG3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.