Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PDXK Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit PDXK Polyclonal Antibody | anti-PDXK antibody

PDXK antibody - middle region

Gene Names
PDXK; PKH; PNK; PRED79; C21orf97; HEL-S-1a; C21orf124
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDXK; Polyclonal Antibody; PDXK antibody - middle region; anti-PDXK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRN
Sequence Length
312
Applicable Applications for anti-PDXK antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PDXK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PDXK Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-PDXK Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-PDXK antibody
This is a rabbit polyclonal antibody against PDXK. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer. The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-PDXK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
pyridoxal kinase isoform 1
NCBI Official Synonym Full Names
pyridoxal kinase
NCBI Official Symbol
PDXK
NCBI Official Synonym Symbols
PKH; PNK; PRED79; C21orf97; HEL-S-1a; C21orf124
NCBI Protein Information
pyridoxal kinase
UniProt Protein Name
Pyridoxal kinase
Protein Family
UniProt Gene Name
PDXK
UniProt Synonym Gene Names
C21orf124; C21orf97; PKH; PNK
UniProt Entry Name
PDXK_HUMAN

NCBI Description

The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PDXK: Required for synthesis of pyridoxal-5-phosphate from vitamin B6. Belongs to the pyridoxine kinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.1.35; Cofactor and Vitamin Metabolism - vitamin B6; Kinase, other

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: potassium ion binding; sodium ion binding; protein homodimerization activity; zinc ion binding; pyridoxal kinase activity; magnesium ion binding; lithium ion binding; ATP binding; pyridoxal phosphate binding

Biological Process: cell proliferation; vitamin metabolic process; vitamin B6 metabolic process; pyridoxal 5'-phosphate salvage; phosphorylation; water-soluble vitamin metabolic process; pyridoxal phosphate biosynthetic process

Research Articles on PDXK

Similar Products

Product Notes

The PDXK pdxk (Catalog #AAA3211406) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDXK antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PDXK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDXK pdxk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RKIHSQEEAL RVMDMLHSMG PDTVVITSSD LPSPQGSNYL IVLGSQRRRN. It is sometimes possible for the material contained within the vial of "PDXK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.