Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PDXK rabbit polyclonal antibody. Western Blot analysis of PDXK expression in A-431.)

Rabbit anti-Human PDXK Polyclonal Antibody | anti-PDXK antibody

PDXK (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) APC

Gene Names
PDXK; PKH; PNK; PRED79; C21orf97; HEL-S-1a; C21orf124
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDXK; Polyclonal Antibody; PDXK (Pyridoxal Kinase; Pyridoxine Kinase; C21orf97; C21orf124; DKFZp566A071; FLJ31940; FLJ37311; MGC15873; MGC31754; MGC52346; PKH; PNK; PRED79) APC; anti-PDXK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PDXK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PDXK antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PDXK, aa1-312 (NP_003672.1)
Immunogen Sequence
MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PDXK rabbit polyclonal antibody. Western Blot analysis of PDXK expression in A-431.)

Western Blot (WB) (PDXK rabbit polyclonal antibody. Western Blot analysis of PDXK expression in A-431.)

Western Blot (WB)

(Western Blot analysis of PDXK expression in transfected 293T cell line by PDXK polyclonal antibody. Lane 1: PDXK transfected lysate (35.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PDXK expression in transfected 293T cell line by PDXK polyclonal antibody. Lane 1: PDXK transfected lysate (35.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PDXK antibody
Pyridoxal kinase (PDXK) converts vitamin B6 to pyridoxal-5-phosphate (PLP), an essential cofactor in the intermediate metabolism of amino acids and neurotransmitters. The PDXK gene encodes a 312aa polypeptide, and expression of the cDNA reveals pyridoxal kinase activity. Northern blot analysis revealed that a major 1.5-kb PDXK transcript is expressed in all tissues tested. The expression of PDXK shows circadian oscillations. The expression of Pdxk in mouse liver and brain is regulated by the 3 PAR bZIP transcription factors, Dbp, Hlf, and Tef, which also show circadian oscillations in expression. Mice devoid of all 3 transcription factors show decreased levels of brain PLP, serotonin, and dopamine, and are highly susceptible to frequently lethal generalized spontaneous and audiogenic epilepsies.
Product Categories/Family for anti-PDXK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,827 Da
NCBI Official Full Name
pyridoxal kinase
NCBI Official Synonym Full Names
pyridoxal (pyridoxine, vitamin B6) kinase
NCBI Official Symbol
PDXK
NCBI Official Synonym Symbols
PKH; PNK; PRED79; C21orf97; HEL-S-1a; C21orf124
NCBI Protein Information
pyridoxal kinase; epididymis secretory sperm binding protein Li 1a; pyridoxamine kinase; pyridoxine kinase; vitamin B6 kinase
UniProt Protein Name
Pyridoxal kinase
Protein Family
UniProt Gene Name
PDXK
UniProt Synonym Gene Names
C21orf124; C21orf97; PKH; PNK
UniProt Entry Name
PDXK_HUMAN

NCBI Description

The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PDXK: Required for synthesis of pyridoxal-5-phosphate from vitamin B6. Belongs to the pyridoxine kinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.1.35; Cofactor and Vitamin Metabolism - vitamin B6; Kinase, other

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: potassium ion binding; sodium ion binding; protein homodimerization activity; zinc ion binding; pyridoxal kinase activity; magnesium ion binding; lithium ion binding; ATP binding; pyridoxal phosphate binding

Biological Process: cell proliferation; vitamin metabolic process; vitamin B6 metabolic process; pyridoxal 5'-phosphate salvage; phosphorylation; water-soluble vitamin metabolic process; pyridoxal phosphate biosynthetic process

Research Articles on PDXK

Similar Products

Product Notes

The PDXK pdxk (Catalog #AAA6388977) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDXK (Pyridoxal Kinase, Pyridoxine Kinase, C21orf97, C21orf124, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDXK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDXK pdxk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDXK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.