Western Blot (WB)
(WB Suggested Anti-Pdlim1 Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Liver)
Rabbit anti-Mouse PDLIM1 Polyclonal Antibody | anti-PDLIM1 antibody
PDLIM1 Antibody - middle region
Gene Names
Pdlim1; CLP36; Clim1; mClim1
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDLIM1; Polyclonal Antibody; PDLIM1 Antibody - middle region; anti-PDLIM1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ISNFNNAVESKTSASGKEANSRPLVQPHPSGSLIIDKESEVYKMLQEKQE
Sequence Length
327
Applicable Applications for anti-PDLIM1 antibody
Western Blot (WB)
Homology
Mouse: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse PDLIM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Pdlim1 Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Liver)
Western Blot (WB)
(WB Suggested Anti-Pdlim1 Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Liver)
Related Product Information for anti-PDLIM1 antibody
The function of this protein remains unknown.
Product Categories/Family for anti-PDLIM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
PDZ and LIM domain protein 1
NCBI Official Synonym Full Names
PDZ and LIM domain 1 (elfin)
NCBI Official Symbol
Pdlim1
NCBI Official Synonym Symbols
CLP36; Clim1; mClim1
NCBI Protein Information
PDZ and LIM domain protein 1
UniProt Protein Name
PDZ and LIM domain protein 1
Protein Family
UniProt Gene Name
Pdlim1
UniProt Synonym Gene Names
Clim1
UniProt Entry Name
PDLI1_MOUSE
Uniprot Description
CLIM1: a cytoskeletal adaptor protein that bring other proteins to the cytoskeleton. Interacts with alpha-actinins 1, 2 and 4. Recruits the Clik1 kinase to actin stress fibers in nonmuscle cells. Strongly expressed in the heart and skeletal muscle, moderately expressed in the spleen, small intestine, colon, placenta, and lung. A lower level expression is seen in liver, thymus, kidney, prostate and pancreas and is not found in the brain, testis, ovary, and peripheral blood leukocytes.
Protein type: Cytoskeletal
Cellular Component: transcription factor complex; cytoskeleton; focal adhesion; cytoplasm
Molecular Function: protein binding; zinc ion binding; metal ion binding; transcription coactivator activity
Biological Process: regulation of transcription, DNA-dependent
Research Articles on PDLIM1
Similar Products
Product Notes
The PDLIM1 pdlim1 (Catalog #AAA3203695) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDLIM1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PDLIM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDLIM1 pdlim1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISNFNNAVES KTSASGKEAN SRPLVQPHPS GSLIIDKESE VYKMLQEKQE. It is sometimes possible for the material contained within the vial of "PDLIM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
