Western Blot (WB)
(WB Suggested Anti-CCDC69 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Rabbit CCDC69 Polyclonal Antibody | anti-CCDC69 antibody
CCDC69 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCDC69; Polyclonal Antibody; CCDC69 antibody - middle region; anti-CCDC69 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT
Sequence Length
296
Applicable Applications for anti-CCDC69 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Pig: 93%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CCDC69
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CCDC69 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Western Blot (WB)
(WB Suggested Anti-CCDC69 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Related Product Information for anti-CCDC69 antibody
This is a rabbit polyclonal antibody against CCDC69. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The function of CCDC69 remains unknown.
Target Description: The function of CCDC69 remains unknown.
Product Categories/Family for anti-CCDC69 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
coiled-coil domain-containing protein 69
NCBI Official Synonym Full Names
coiled-coil domain containing 69
NCBI Official Symbol
CCDC69
NCBI Protein Information
coiled-coil domain-containing protein 69
UniProt Protein Name
Coiled-coil domain-containing protein 69
Protein Family
UniProt Gene Name
CCDC69
UniProt Entry Name
CCD69_HUMAN
Uniprot Description
CCDC69:
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 5q33.1
Research Articles on CCDC69
Similar Products
Product Notes
The CCDC69 ccdc69 (Catalog #AAA3212148) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCDC69 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC69 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCDC69 ccdc69 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TREALEKEVQ LRRQLQQEKE ELLYRVLGAN ASPAFPLAPV TPTEVSFLAT. It is sometimes possible for the material contained within the vial of "CCDC69, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
