Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ALS2CR4 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Rabbit ALS2CR4 Polyclonal Antibody | anti-TMEM237 antibody

ALS2CR4 antibody - middle region

Gene Names
TMEM237; JBTS14; ALS2CR4
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ALS2CR4; Polyclonal Antibody; ALS2CR4 antibody - middle region; anti-TMEM237 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGDQLSNLSNLLQQYKTLAYPFQSLLYLLLALSTISAFDRIDFAKISVAI
Sequence Length
408
Applicable Applications for anti-TMEM237 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 85%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ALS2CR4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ALS2CR4 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-ALS2CR4 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Related Product Information for anti-TMEM237 antibody
This is a rabbit polyclonal antibody against ALS2CR4. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-TMEM237 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
transmembrane protein 237 isoform a
NCBI Official Synonym Full Names
transmembrane protein 237
NCBI Official Symbol
TMEM237
NCBI Official Synonym Symbols
JBTS14; ALS2CR4
NCBI Protein Information
transmembrane protein 237
UniProt Protein Name
Transmembrane protein 237
Protein Family
UniProt Gene Name
TMEM237
UniProt Synonym Gene Names
ALS2CR4
UniProt Entry Name
TM237_HUMAN

NCBI Description

The protein encoded by this gene is a tetraspanin protein that is thought to be involved in WNT signaling. Defects in this gene are a cause of Joubert syndrome-14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

ALS2CR4: Component of the transition zone in primary cilia. Required for ciliogenesis. Defects in TMEM237 are the cause of Joubert syndrome type 14 (JBTS14). An autosomal recessive disorder characterized by severe mental retardation, hypotonia, breathing abnormalities in infancy, and dysmorphic facial features. Neuroradiologically, it is characterized by cerebellar vermian hypoplasia/aplasia, thickened and reoriented superior cerebellar peduncles, and an abnormally large interpeduncular fossa, giving the appearance of a molar tooth on transaxial slices (molar tooth sign). Additional variable JBTS14 features include renal disease, abnormal eye movements, and postaxial polydactyly. Belongs to the TMEM237 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2q33.2

Cellular Component: membrane; integral to membrane

Biological Process: regulation of Wnt receptor signaling pathway; cilium biogenesis

Disease: Joubert Syndrome 1; Joubert Syndrome 14

Research Articles on TMEM237

Similar Products

Product Notes

The TMEM237 tmem237 (Catalog #AAA3207607) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALS2CR4 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALS2CR4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMEM237 tmem237 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGDQLSNLSN LLQQYKTLAY PFQSLLYLLL ALSTISAFDR IDFAKISVAI. It is sometimes possible for the material contained within the vial of "ALS2CR4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.