Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PDHA2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Rabbit PDHA2 Polyclonal Antibody | anti-PDHA2 antibody
PDHA2 Polyclonal Antibody
Gene Names
PDHA2; PDHAL
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PDHA2; Polyclonal Antibody; PDHA2 Polyclonal Antibody; PDHAL; anti-PDHA2 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELKEIDADVKKEVEDAAQFATTDPEPAVEDIANYLYHQDPPFEVRGAHKWLKYKSHS
Sequence Length
388
Applicable Applications for anti-PDHA2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
A synthetic peptide of mouse PDHA2
Immunogen Species
Mouse
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Mitochondrion matrix
Positive Samples
PC-12, Mouse testis, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PDHA2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PDHA2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Product Categories/Family for anti-PDHA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 43kDa
Observed: 43kDa
Observed: 43kDa
NCBI Official Full Name
pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
NCBI Official Synonym Full Names
pyruvate dehydrogenase E1 alpha 2 subunit
NCBI Official Symbol
PDHA2
NCBI Official Synonym Symbols
PDHAL
NCBI Protein Information
pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
UniProt Protein Name
Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
Protein Family
UniProt Gene Name
PDHA2
UniProt Synonym Gene Names
PDHAL
Uniprot Description
The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2, and thereby links the glycolytic pathway to the tricarboxylic cycle.
Research Articles on PDHA2
Similar Products
Product Notes
The PDHA2 pdha2 (Catalog #AAA9134984) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDHA2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDHA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the PDHA2 pdha2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ISYRSREEVH NVRSKSDPIM LLRERIISNN LSNIEELKEI DADVKKEVED AAQFATTDPE PAVEDIANYL YHQDPPFEVR GAHKWLKYKS HS. It is sometimes possible for the material contained within the vial of "PDHA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
