Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PDHA2 expression in transfected 293T cell line by PDHA2 polyclonal antibody. Lane 1: PDHA2 transfected lysate (42.68kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PDHA2 Polyclonal Antibody | anti-PDHA2 antibody

PDHA2 (PDHAL, Pyruvate Dehydrogenase E1 Component Subunit alpha, Testis-specific Form, Mitochondrial, PDHE1-A Type II, MGC149517, MGC149518)

Gene Names
PDHA2; PDHAL
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PDHA2; Polyclonal Antibody; PDHA2 (PDHAL; Pyruvate Dehydrogenase E1 Component Subunit alpha; Testis-specific Form; Mitochondrial; PDHE1-A Type II; MGC149517; MGC149518); Anti -PDHA2 (PDHAL; anti-PDHA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PDHA2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS
Applicable Applications for anti-PDHA2 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human PDHA2, aa1-388 (NP_005381.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PDHA2 expression in transfected 293T cell line by PDHA2 polyclonal antibody. Lane 1: PDHA2 transfected lysate (42.68kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PDHA2 expression in transfected 293T cell line by PDHA2 polyclonal antibody. Lane 1: PDHA2 transfected lysate (42.68kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to PDHA2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified antibody to PDHA2 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-PDHA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,933 Da
NCBI Official Full Name
pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
NCBI Official Synonym Full Names
pyruvate dehydrogenase (lipoamide) alpha 2
NCBI Official Symbol
PDHA2
NCBI Official Synonym Symbols
PDHAL
NCBI Protein Information
pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial; PDHE1-A type II; pyruvate dehydrogenase, E1-alpha polypeptide, testis specific
UniProt Protein Name
Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
UniProt Gene Name
PDHA2
UniProt Synonym Gene Names
PDHAL
UniProt Entry Name
ODPAT_HUMAN

Uniprot Description

PDHA2: a testis-specific mitochondrial matrix enzyme that catalyzes the oxidative decarboxylation of pyruvate, producing acetyl-CoA and CO2. A key enzyme in controlling the balance between lipid and glucose oxidation depending on substrate availability. The pyruvate dehydrogenase (PDH) holoenzyme is a multi-enzyme complex (PDHC) that contains 20-30 copies of pyruvate decarboxylase tetramers (2 alpha:2 beta)(E1), 60 copies of dihydrolipoamide acetyltransferase (E2), six homodimers of dihydrolipoamide dehydrogenase (E3), plus E3 binding proteins. The activity of PDH is tightly regulated by phosphorylation. The phosphorylation of at least one of three specific serine residues in E1 subunit by PDHK inactivates the PDHC, while dephosphorylation by PDP restores its activity. Expressed in postmeiotic spermatogenic cells.

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Carbohydrate Metabolism - citrate (TCA) cycle; Amino Acid Metabolism - valine, leucine and isoleucine biosynthesis; Carbohydrate Metabolism - pyruvate; Carbohydrate Metabolism - butanoate; EC 1.2.4.1; Mitochondrial; Oxidoreductase

Chromosomal Location of Human Ortholog: 4q22-q23

Cellular Component: mitochondrial matrix; nucleus

Molecular Function: pyruvate dehydrogenase (acetyl-transferring) activity

Biological Process: glycolysis; tricarboxylic acid cycle; glucose metabolic process; pyruvate metabolic process

Research Articles on PDHA2

Similar Products

Product Notes

The PDHA2 pdha2 (Catalog #AAA6006536) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDHA2 (PDHAL, Pyruvate Dehydrogenase E1 Component Subunit alpha, Testis-specific Form, Mitochondrial, PDHE1-A Type II, MGC149517, MGC149518) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDHA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the PDHA2 pdha2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLAAFISRVL RRVAQKSARR VLVASRNSSN DATFEIKKCD LYLLEEGPPV TTVLTRAEGL KYYRMMLTVR RMELKADQLY KQKFIRGFCH LCDGQEACCV GLEAGINPSD HVITSYRAHG VCYTRGLSVR SILAELTGRR GGCAKGKGGS MHMYTKNFYG GNGIVGAQGP LGAGIALACK YKGNDEICLT LYGDGAANQG QIAEAFNMAA LWKLPCVFIC ENNLYGMGTS TERAAASPDY YKRGNFIPGL KVDGMDVLCV REATKFAANY CRSGKGPILM ELQTYRYHGH SMSDPGVSYR TREEIQEVRS KRDPIIILQD RMVNSKLATV EELKEIGAEV RKEIDDAAQF ATTDPEPHLE ELGHHIYSSD SSFEVRGANP WIKFKSVS. It is sometimes possible for the material contained within the vial of "PDHA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.