Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PDE8B AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit PDE8B Polyclonal Antibody | anti-PDE8B antibody

PDE8B antibody - middle region

Gene Names
PDE8B; ADSD; PPNAD3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDE8B; Polyclonal Antibody; PDE8B antibody - middle region; anti-PDE8B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHL
Sequence Length
788
Applicable Applications for anti-PDE8B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PDE8B AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-PDE8B AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-PDE8B antibody
This is a rabbit polyclonal antibody against PDE8B. It was validated on Western Blot

Target Description: The protein encoded by this gene is a cyclic nucleotide phosphodiesterase (PDE) that catalyzes the hydrolysis of the second messenger cAMP. The encoded protein, which does not hydrolyze cGMP, is resistant to several PDE inhibitors. Defects in this gene are a cause of autosomal dominant striatal degeneration (ADSD). Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PDE8B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B isoform 3
NCBI Official Synonym Full Names
phosphodiesterase 8B
NCBI Official Symbol
PDE8B
NCBI Official Synonym Symbols
ADSD; PPNAD3
NCBI Protein Information
high affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B
UniProt Protein Name
High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B
UniProt Gene Name
PDE8B
UniProt Synonym Gene Names
HsPDE8B
UniProt Entry Name
PDE8B_HUMAN

NCBI Description

The protein encoded by this gene is a cyclic nucleotide phosphodiesterase (PDE) that catalyzes the hydrolysis of the second messenger cAMP. The encoded protein, which does not hydrolyze cGMP, is resistant to several PDE inhibitors. Defects in this gene are a cause of autosomal dominant striatal degeneration (ADSD). Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010]

Uniprot Description

PDE8B: Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in specific signaling in the thyroid gland. Defects in PDE8B are the cause of striatal degeneration autosomal dominant (ADSD). It is a movement disorder affecting the striatal part of the basal ganglia and characterized by bradykinesia, dysarthria and muscle rigidity. These symptoms resemble idiopathic Parkinson disease, but tremor is not present. Defects in PDE8B are the cause of primary pigmented nodular adrenocortical disease type 3 (PPNAD3). PPNAD3 is a rare bilateral adrenal defect causing ACTH-independent Cushing syndrome. Macroscopic appearance of the adrenals is characteristic with small pigmented micronodules observed in the cortex. Adrenal glands show overall normal size and weight, and multiple small yellow-to-dark brown nodules surrounded by a cortex with a uniform appearance. Microscopically, there are moderate diffuse cortical hyperplasia with mostly nonpigmented nodules, multiple capsular deficits and massive circumscribed and infiltrating extra-adrenal cortical excrescences with micronodules. Clinical manifestations of Cushing syndrome include facial and trunkal obesity, abdominal striae, muscular weakness, osteoporosis, arterial hypertension, diabetes. Belongs to the cyclic nucleotide phosphodiesterase family. PDE8 subfamily. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleotide Metabolism - purine; Phosphodiesterase; EC 3.1.4.53

Chromosomal Location of Human Ortholog: 5q13.3

Cellular Component: cytosol

Molecular Function: 3',5'-cyclic-AMP phosphodiesterase activity; signal transducer activity; metal ion binding; 3',5'-cyclic-nucleotide phosphodiesterase activity

Biological Process: cyclic nucleotide metabolic process; behavioral fear response; operant conditioning; cAMP catabolic process; two-component signal transduction system (phosphorelay); visual learning; neuromuscular process controlling balance; negative regulation of insulin secretion

Disease: Striatal Degeneration, Autosomal Dominant; Pigmented Nodular Adrenocortical Disease, Primary, 3

Research Articles on PDE8B

Similar Products

Product Notes

The PDE8B pde8b (Catalog #AAA3216489) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDE8B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PDE8B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDE8B pde8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TELYSPQLGT KDEDPHTSDL VGGLMTDGLR RLSGNEYVFT KNVHQSHSHL. It is sometimes possible for the material contained within the vial of "PDE8B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.