Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PDCD8 antibody (MBS839007) used at 0.25 ug/ml to detect target protein.)

Rabbit PDCD8 Polyclonal Antibody | anti-PDCD8 antibody

PDCD8 antibody

Gene Names
AIFM1; AIF; CMT2D; CMTX4; COWCK; NADMR; NAMSD; PDCD8; COXPD6
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot
Purity
Affinity purified
Synonyms
PDCD8; Polyclonal Antibody; PDCD8 antibody; Polyclonal PDCD8; Anti-PDCD8; PDCD-8; PDCD 8; Programmed Cell Death 8; anti-PDCD8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
PDCD8 antibody was raised against the C terminal Of Pdcd8
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDCD8 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
613
Applicable Applications for anti-PDCD8 antibody
Western Blot (WB)
Application Notes
WB: 0.25 ug/ml
Biological Significance
AIFM1 (PDCD8) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, AIFM1 induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
PDCD8 antibody was raised using the C terminal Of Pdcd8 corresponding to a region with amino acids VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(PDCD8 antibody (MBS839007) used at 0.25 ug/ml to detect target protein.)

Western Blot (WB) (PDCD8 antibody (MBS839007) used at 0.25 ug/ml to detect target protein.)
Related Product Information for anti-PDCD8 antibody
Rabbit polyclonal PDCD8 antibody raised against the C terminal Of Pdcd8
Product Categories/Family for anti-PDCD8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
36 kDa (MW of target protein)
NCBI Official Full Name
PDCD8
NCBI Official Synonym Full Names
apoptosis-inducing factor, mitochondrion-associated, 1
NCBI Official Symbol
AIFM1
NCBI Official Synonym Symbols
AIF; CMT2D; CMTX4; COWCK; NADMR; NAMSD; PDCD8; COXPD6
NCBI Protein Information
apoptosis-inducing factor 1, mitochondrial
UniProt Protein Name
Apoptosis-inducing factor 1, mitochondrial
UniProt Gene Name
AIFM1
UniProt Synonym Gene Names
AIF; PDCD8
UniProt Entry Name
AIFM1_HUMAN

NCBI Description

This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 10. [provided by RefSeq, May 2010]

Uniprot Description

PDCD8: Probable oxidoreductase that has a dual role in controlling cellular life and death; during apoptosis, it is translocated from the mitochondria to the nucleus to function as a proapoptotic factor in a caspase-independent pathway, while in normal mitochondria, it functions as an antiapoptotic factor via its oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e., caspase-independent fragmentation of chromosomal DNA. Interacts with EIF3G,and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. Plays a critical role in caspase- independent, pyknotic cell death in hydrogen peroxide-exposed cells. Binds to DNA in a sequence-independent manner. Interacts with XIAP/BIRC4. Interacts (via N-terminus) with EIF3G (via C-terminus). Belongs to the FAD-dependent oxidoreductase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Oxidoreductase; Apoptosis; EC 1.-.-.-

Chromosomal Location of Human Ortholog: Xq26.1

Cellular Component: mitochondrion; perinuclear region of cytoplasm; mitochondrial inner membrane; mitochondrial intermembrane space; cytosol; nucleus

Molecular Function: protein dimerization activity; protein binding; oxidoreductase activity, acting on NADH or NADPH; DNA binding; electron carrier activity; NAD(P)H oxidase activity

Biological Process: chromosome condensation; caspase activation; neuron differentiation; mitochondrial respiratory chain complex I assembly; neuron apoptosis; cell redox homeostasis; apoptosis; positive regulation of apoptosis; DNA fragmentation during apoptosis; DNA catabolic process

Disease: Cowchock Syndrome

Research Articles on PDCD8

Similar Products

Product Notes

The PDCD8 aifm1 (Catalog #AAA839007) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDCD8 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's PDCD8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.25 ug/ml. Researchers should empirically determine the suitability of the PDCD8 aifm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDCD8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.