Rabbit PDCD10 Polyclonal Antibody | anti-PDCD10 antibody

PDCD10 Polyclonal Antibody

Cat. Num. AAA9141044

• Gene Names: PDCD10; CCM3; TFAR15
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purification
• Synonyms: PDCD10; Polyclonal Antibody; PDCD10 Polyclonal Antibody; CCM3; TFAR15; programmed cell death 10; anti-PDCD10 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 1.08 mg/ml (varies by lot)
• Sequence Length: 212

• Applicable Applications for anti-PDCD10 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: WB: 1:500-1:2000; IHC: 1:50-1:200
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-212 of human PDCD10 (NP_009148.2).
• Immunogen Sequence: MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Related Product Information for anti-PDCD10 antibody

This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified.

NCBI and Uniprot Product Information

• NCBI GI #: 74733232
• NCBI GeneID: 11235
• UniProt Accession #: Q9BUL8
• Molecular Weight: 24kDa
• NCBI Official Full Name: Programmed cell death protein 10
• NCBI Official Synonym Full Names: programmed cell death 10
• NCBI Official Symbol: PDCD10
• NCBI Official Synonym Symbols: CCM3; TFAR15
• NCBI Protein Information: programmed cell death protein 10
• UniProt Protein Name: Programmed cell death protein 10
• Protein Family: Programmed cell death protein
• UniProt Gene Name: PDCD10
• UniProt Synonym Gene Names: CCM3; TFAR15
• UniProt Entry Name: PDC10_HUMAN

NCBI Description

This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

PDCD10: Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and MST4 activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development. Defects in PDCD10 are the cause of cerebral cavernous malformations type 3 (CCM3). Cerebral cavernous malformations (CCMs) are congenital vascular anomalies of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. CCMs have an incidence of 0.1%-0.5% in the general population and usually present clinically during the 3rd to 5th decade of life. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters. Belongs to the PDCD10 family.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 3q26.1

Cellular Component: Golgi membrane; Golgi apparatus; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; protein homodimerization activity; protein N-terminus binding; protein kinase binding

Biological Process: protein stabilization; positive regulation of peptidyl-serine phosphorylation; positive regulation of stress-activated MAPK cascade; positive regulation of MAP kinase activity; response to hydrogen peroxide; establishment of Golgi localization; positive regulation of cell proliferation; stress fiber formation; regulation of Rho protein signal transduction; angiogenesis; positive regulation of Notch signaling pathway; negative regulation of apoptosis; positive regulation of cell migration

Disease: Cerebral Cavernous Malformations 3