Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry-PDCD10 Polyclonal Antibody)

Rabbit PDCD10 Polyclonal Antibody | anti-PDCD10 antibody

PDCD10 Polyclonal Antibody

Gene Names
PDCD10; CCM3; TFAR15
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
PDCD10; Polyclonal Antibody; PDCD10 Polyclonal Antibody; CCM3; TFAR15; programmed cell death 10; anti-PDCD10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.08 mg/ml (varies by lot)
Sequence Length
212
Applicable Applications for anti-PDCD10 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-212 of human PDCD10 (NP_009148.2).
Immunogen Sequence
MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC) (Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC) (Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC) (Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC) (Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC) (Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC) (Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-PDCD10 Polyclonal Antibody)

Immunohistochemistry (IHC) (Immunohistochemistry-PDCD10 Polyclonal Antibody)
Related Product Information for anti-PDCD10 antibody
This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
Programmed cell death protein 10
NCBI Official Synonym Full Names
programmed cell death 10
NCBI Official Symbol
PDCD10
NCBI Official Synonym Symbols
CCM3; TFAR15
NCBI Protein Information
programmed cell death protein 10
UniProt Protein Name
Programmed cell death protein 10
UniProt Gene Name
PDCD10
UniProt Synonym Gene Names
CCM3; TFAR15
UniProt Entry Name
PDC10_HUMAN

NCBI Description

This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

PDCD10: Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and MST4 activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development. Defects in PDCD10 are the cause of cerebral cavernous malformations type 3 (CCM3). Cerebral cavernous malformations (CCMs) are congenital vascular anomalies of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. CCMs have an incidence of 0.1%-0.5% in the general population and usually present clinically during the 3rd to 5th decade of life. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters. Belongs to the PDCD10 family.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 3q26.1

Cellular Component: Golgi membrane; Golgi apparatus; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; protein homodimerization activity; protein N-terminus binding; protein kinase binding

Biological Process: protein stabilization; positive regulation of peptidyl-serine phosphorylation; positive regulation of stress-activated MAPK cascade; positive regulation of MAP kinase activity; response to hydrogen peroxide; establishment of Golgi localization; positive regulation of cell proliferation; stress fiber formation; regulation of Rho protein signal transduction; angiogenesis; positive regulation of Notch signaling pathway; negative regulation of apoptosis; positive regulation of cell migration

Disease: Cerebral Cavernous Malformations 3

Research Articles on PDCD10

Similar Products

Product Notes

The PDCD10 pdcd10 (Catalog #AAA9141044) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDCD10 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDCD10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the PDCD10 pdcd10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDCD10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.