Rabbit anti-Human PBX2 Polyclonal Antibody | anti-PBX2 antibody

PBX2 (G17, Pre-B-cell Leukemia Transcription Factor 2, Homeobox Protein PBX2, Protein G17)

Cat. Num. AAA643742

• Gene Names: PBX2; G17; HOX12; PBX2MHC
• Reactivity: Human
• Applications: Immunoprecipitation
• Purity: Serum; Serum
• Synonyms: PBX2; Polyclonal Antibody; PBX2 (G17; Pre-B-cell Leukemia Transcription Factor 2; Homeobox Protein PBX2; Protein G17); Anti -PBX2 (G17; anti-PBX2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PBX2.
• Purity/Purification: Serum; Serum
• Form/Format: Supplied as a liquid.
• Sequence: MDERLLGPPPPGGGRGGLGLVSGEPGGPGEPPGGGDPGGGSGGVPGGRGKQDIGDILQQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRSSQEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYEQACNEFTTHVMNLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAVKTAVSVTQGGHSRTSSPTPPSSAGSGGSFNLSGSGDMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN

• Applicable Applications for anti-PBX2 antibody: Immunoprecipitation (IP)
• Application Notes: Suitable for use in Immunoprecipitation.
• Immunogen: Full length human PBX2, aa1-430 (NP_002577.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of PBX2 transfected lysate using PBX2 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with PBX2 monoclonal antibody.)

Related Product Information for anti-PBX2 antibody

This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6. [provided by RefSeq]

Product Categories/Family for anti-PBX2 antibody

Antibodies; Abs to Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 27436887
• NCBI GeneID: 5089
• NCBI Accession #: NP_002577.2
• NCBI GenBank Nucleotide #: NM_002586.4
• UniProt Accession #: P40425; A2BFJ2
• Molecular Weight: 45,881 Da
• NCBI Official Full Name: pre-B-cell leukemia transcription factor 2
• NCBI Official Synonym Full Names: pre-B-cell leukemia homeobox 2
• NCBI Official Symbol: PBX2
• NCBI Official Synonym Symbols: G17; HOX12; PBX2MHC
• NCBI Protein Information: pre-B-cell leukemia transcription factor 2; homeobox 12; homeobox protein PBX2
• UniProt Protein Name: Pre-B-cell leukemia transcription factor 2
• Protein Family: Pre-B-cell leukemia transcription factor
• UniProt Gene Name: PBX2
• UniProt Synonym Gene Names: G17
• UniProt Entry Name: PBX2_HUMAN

NCBI Description

This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6. [provided by RefSeq, Jul 2008]

Uniprot Description

PBX2: Transcriptional activator that binds the sequence 5'- ATCAATCAA-3'. Activates transcription of PF4 in complex with MEIS1. Belongs to the TALE/PBX homeobox family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: transcription factor complex; nucleus

Molecular Function: sequence-specific DNA binding; chromatin binding; transcription factor binding; transcription factor activity

Biological Process: transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; proximal/distal pattern formation; embryonic limb morphogenesis