Pax2 Polyclonal Antibody | anti-PAX2 antibody

Anti-Pax2 Antibody

Cat. Num. AAA178017

• Gene Names: PAX2; FSGS7; PAPRS
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: Pax2; Polyclonal Antibody; Anti-Pax2 Antibody; Paired box protein Pax-2; Paired box 2; Paired box gene 2; paired box homeotic gene 2; paired box protein 2; Paired box protein Pax 2; Paired box protein Pax2; Pax 2; paired box 2; anti-PAX2 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 394

• Applicable Applications for anti-PAX2 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Pax2 (248-282aa RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH), identical to the related mouse sequence.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Pax2 Picoband antibody, MBS178017, Western blottingAll lanes: Anti Pax2 (MBS178017) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugPredicted bind size: 45KDObserved bind size: 45KD )

Immunohistochemistry (IHC)

(Anti- Pax2 Picoband antibody, MBS178017,IHC(P)IHC(P): Mouse Lymphaden Tissue )

Immunohistochemistry (IHC)

(Anti- Pax2 Picoband antibody, MBS178017,IHC(P)IHC(P): Rat Lymphaden Tissue )

Immunohistochemistry (IHC)

(Anti- Pax2 Picoband antibody, MBS178017,IHC(P)IHC(P): Human Tonsil Tissue )

Related Product Information for anti-PAX2 antibody

Description: Rabbit IgG polyclonal antibody for Paired box protein Pax-2(PAX2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Paired box gene 2, also known as PAX2, is a protein which in humans is encoded by the PAX2 gene. This gene is mapped to 10q24. PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.

References

1. "Entrez Gene: PAX2 paired box gene 2". 2. Pilz AJ, Povey S, Gruss P, Abbott CM (1993). "Mapping of the human homologs of the murine paired-box-containing genes". Mamm. Genome 4 (2): 78-82. 3. Pfeffer, Peter L.; Bernhard Payter; Gerlinde Reim; Marina Pasca di Magliano; Meinrad Busslinger (2001). "The activation and maintenance of Pax2 expression at the mid-hindbrain boundary is controlled by separate enhancers". Development (133): 307-318.

NCBI and Uniprot Product Information

• NCBI GI #: 1003701522
• NCBI GeneID: 5076
• NCBI Accession #: NP_000269.3
• NCBI GenBank Nucleotide #: NM_000278.4
• UniProt Accession #: Q02962; Q15105; Q15110; Q15837; Q5SZP2; Q5SZP3
• Molecular Weight: 41,956 Da
• NCBI Official Full Name: paired box protein Pax-2 isoform b
• NCBI Official Synonym Full Names: paired box 2
• NCBI Official Symbol: PAX2
• NCBI Official Synonym Symbols: FSGS7; PAPRS
• NCBI Protein Information: paired box protein Pax-2
• UniProt Protein Name: Paired box protein Pax-2
• Protein Family: Paired box protein
• UniProt Gene Name: PAX2
• UniProt Entry Name: PAX2_HUMAN

NCBI Description

PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

PAX2: Probable transcription factor that may have a role in kidney cell differentiation. Has a critical role in the development of the urogenital tract, the eyes, and the CNS. Interacts with ELGN3; the interaction targets PAX2 for destruction. Expressed in primitive cells of the kidney, ureter, eye, ear and central nervous system. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 10q24

Cellular Component: Golgi apparatus; lysosome; microtubule organizing center; nucleolus; nucleus; protein complex

Molecular Function: DNA binding; protein binding; superoxide-generating NADPH oxidase activity; transcription factor binding

Biological Process: aging; axonogenesis; brain morphogenesis; camera-type eye development; cell fate determination; glial cell differentiation; inner ear morphogenesis; mesodermal cell fate specification; mesonephros development; negative regulation of apoptosis; negative regulation of caspase activity; negative regulation of cytolysis; negative regulation of programmed cell death; negative regulation of transcription, DNA-dependent; neural tube closure; optic cup morphogenesis involved in camera-type eye development; optic nerve development; optic nerve morphogenesis; optic nerve structural organization; positive regulation of epithelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; pronephros development; protein kinase B signaling cascade; response to nutrient levels; stem cell differentiation; transcription from RNA polymerase II promoter; transcription, DNA-dependent; ureteric bud branching; urogenital system development; vestibulocochlear nerve formation; visual perception

Disease: Focal Segmental Glomerulosclerosis 7; Papillorenal Syndrome; Renal Hypodysplasia/aplasia 1