Western Blot (WB)
(Western Blot analysis of GFRA1 expression in transfected 293T cell line by GFRA1 monoclonal antibody (M11), clone 3D8.Lane 1: GFRA1 transfected lysate (50.8 KDa).Lane 2: Non-transfected lysate.)
Mouse GFRA1 Monoclonal Antibody | anti-GFRA1 antibody
GFRA1 (GDNF Family Receptor alpha 1, GDNFR, GDNFRA, GFR-ALPHA-1, MGC23045, RET1L, RETL1, TRNR1) (Biotin)
Gene Names
GFRA1; GDNFR; RET1L; RETL1; TRNR1; GDNFRA; GFR-ALPHA-1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
GFRA1; Monoclonal Antibody; GFRA1 (GDNF Family Receptor alpha 1; GDNFR; GDNFRA; GFR-ALPHA-1; MGC23045; RET1L; RETL1; TRNR1) (Biotin); GDNF Family Receptor alpha 1; TRNR1; anti-GFRA1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D8
Specificity
Recognizes GFRA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GFRA1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GFRA1 (NP_005255, 32aa-119aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of GFRA1 expression in transfected 293T cell line by GFRA1 monoclonal antibody (M11), clone 3D8.Lane 1: GFRA1 transfected lysate (50.8 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of GFRA1 expression in transfected 293T cell line by GFRA1 monoclonal antibody (M11), clone 3D8.Lane 1: GFRA1 transfected lysate (50.8 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-GFRA1 antibody
Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq]
Product Categories/Family for anti-GFRA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,838 Da
NCBI Official Full Name
GDNF family receptor alpha-1 isoform a preproprotein
NCBI Official Synonym Full Names
GDNF family receptor alpha 1
NCBI Official Symbol
GFRA1
NCBI Official Synonym Symbols
GDNFR; RET1L; RETL1; TRNR1; GDNFRA; GFR-ALPHA-1
NCBI Protein Information
GDNF family receptor alpha-1
Protein Family
NCBI Description
Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Feb 2009]
Research Articles on GFRA1
Similar Products
Product Notes
The GFRA1 (Catalog #AAA6173432) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GFRA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GFRA1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GFRA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
