PAK5 Polyclonal Antibody | anti-PAK5 antibody

Anti-PAK5 Antibody

Cat. Num. AAA178142

• Gene Names: PAK7; PAK5
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: PAK5; Polyclonal Antibody; Anti-PAK5 Antibody; Serine/threonine-protein kinase PAK 7; EC 2.7.11.1; KIAA1264; MGC26232; p21 activated kinase 7; p21 protein (Cdc42/Rac)-activated kinase 7; p21(CDKN1A) activated kinase 7; p21-activated kinase 5; p21-activated kinase 7; PAK 5; PAK 7; PAK-5; PAK-7; PAK7; PAK7_HUMAN; Protein kinase PAK5; Serine/threonine protein kinase PAK 7; anti-PAK5 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 719

• Applicable Applications for anti-PAK5 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PAK5 (26-55aa DPQEQKFTGLPQQWHSLLADTANRPKPMVD), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- PAK5 Picoband antibody, MBS178142, Western blottingAll lanes: Anti PAK5 (MBS178142) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: U87 Whole Cell Lysate at 40ugPredicted bind size: 81KDObserved bind size: 81KD )

Immunohistochemistry (IHC)

(Anti- PAK5 Picoband antibody, MBS178142, IHC(P)IHC(P): Human Glioma Tissue )

Related Product Information for anti-PAK5 antibody

Description: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase PAK 7(PAK7) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Serine/threonine-protein kinase PAK 7, also known as PAK5, is an enzyme that in humans is encoded by the PAK7 gene. The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases. PAK family members are known to be effectors of Rac/Cdc42 GTPases, which have been implicated in the regulation of cytoskeletal dynamics, proliferation, and cell survival signaling. This kinase contains a CDC42/Rac1 interactive binding (CRIB) motif, and has been shown to bind CDC42 in the presence of GTP. And this kinase is predominantly expressed in brain. It is capable of promoting neurite outgrowth, and thus may play a role in neurite development. In addition, this kinase is associated with microtubule networks and induces microtubule stabilization. The subcellular localization of this kinase is tightly regulated during cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described.

References

1. "Entrez Gene: PAK7 p21(CDKN1A)-activated kinase 7". 2. Dan C, Nath N, Liberto M, Minden A (Dec 2001). "PAK5, a new brain-specific kinase, promotes neurite outgrowth in N1E-115 cells". Mol Cell Biol 22 (2): 567-77. 3. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O (Jan 2000). "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro". DNA Res 6 (5): 337-45.

NCBI and Uniprot Product Information

• NCBI GI #: 24308191
• NCBI GeneID: 57144
• NCBI Accession #: NP_065074.1
• NCBI GenBank Nucleotide #: NM_020341.3
• UniProt Accession #: Q9P286; Q5W115; Q9BX09; Q9ULF6; A8K5T6; D3DW14
• Molecular Weight: 80,745 Da
• NCBI Official Full Name: serine/threonine-protein kinase PAK 7
• NCBI Official Synonym Full Names: p21 (RAC1) activated kinase 7
• NCBI Official Symbol: PAK7
• NCBI Official Synonym Symbols: PAK5
• NCBI Protein Information: serine/threonine-protein kinase PAK 7
• UniProt Protein Name: Serine/threonine-protein kinase PAK 7
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: PAK7
• UniProt Synonym Gene Names: KIAA1264; PAK5; PAK-5; PAK-7
• UniProt Entry Name: PAK7_HUMAN

NCBI Description

The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases. PAK family members are known to be effectors of Rac/Cdc42 GTPases, which have been implicated in the regulation of cytoskeletal dynamics, proliferation, and cell survival signaling. This kinase contains a CDC42/Rac1 interactive binding (CRIB) motif, and has been shown to bind CDC42 in the presence of GTP. This kinase is predominantly expressed in brain. It is capable of promoting neurite outgrowth, and thus may play a role in neurite development. This kinase is associated with microtubule networks and induces microtubule stabilization. The subcellular localization of this kinase is tightly regulated during cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

PAK5: a protein kinase of the STE20 family. Predominantly expressed in brain. Capable of promoting neurite outgrowth, and thus may play a role in neurite development. Associated with microtubule networks and induces microtubule stabilization. Its subcellular localization is tightly regulated during cell cycle progression.

Protein type: Kinase, protein; Protein kinase, STE; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); STE group; STE20 family; PAKB subfamily

Chromosomal Location of Human Ortholog: 20p12

Cellular Component: cytoplasm; mitochondrion; nucleus

Molecular Function: ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: apoptosis; cell growth; cell migration; cell proliferation; cytoskeleton organization and biogenesis; learning; locomotory behavior; memory; mitotic cell cycle; signal transduction