Western Blot (WB)
(WB Suggested Anti-PACS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)
Rabbit PACS2 Polyclonal Antibody | anti-PACS2 antibody
PACS2 antibody - middle region
Gene Names
PACS2; EIEE66; PACS-2; PACS1L
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PACS2; Polyclonal Antibody; PACS2 antibody - middle region; anti-PACS2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AHQLPIAEAMLTYKQKSPDEESSQKFIPFVGVVKVGIVEPSSATSGDSDD
Sequence Length
889
Applicable Applications for anti-PACS2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PACS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PACS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)
Western Blot (WB)
(WB Suggested Anti-PACS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)
Related Product Information for anti-PACS2 antibody
This is a rabbit polyclonal antibody against PACS2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PACS2 is the multifunctional sorting protein that controls the endoplasmic reticulum (ER)-mitochondria communication, including the apposition of mitochondria with the ER and ER homeostasis. In addition, in response to apoptic inducer,PACS2 translocates BIB to mitochondria, which initiates a sequence of events including the formation of mitochondrial truncated BID, the release of cytochrome c, the activation of caspase-3 thereby causing cell death.PACS2 may also be involved in ion channel trafficking, directing acidic cluster-containing ion channels to distinct subcellular compartments.
Target Description: PACS2 is the multifunctional sorting protein that controls the endoplasmic reticulum (ER)-mitochondria communication, including the apposition of mitochondria with the ER and ER homeostasis. In addition, in response to apoptic inducer,PACS2 translocates BIB to mitochondria, which initiates a sequence of events including the formation of mitochondrial truncated BID, the release of cytochrome c, the activation of caspase-3 thereby causing cell death.PACS2 may also be involved in ion channel trafficking, directing acidic cluster-containing ion channels to distinct subcellular compartments.
Product Categories/Family for anti-PACS2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
phosphofurin acidic cluster sorting protein 2 isoform 2
NCBI Official Synonym Full Names
phosphofurin acidic cluster sorting protein 2
NCBI Official Symbol
PACS2
NCBI Official Synonym Symbols
EIEE66; PACS-2; PACS1L
NCBI Protein Information
phosphofurin acidic cluster sorting protein 2
UniProt Protein Name
Phosphofurin acidic cluster sorting protein 2
Protein Family
UniProt Gene Name
PACS2
UniProt Synonym Gene Names
KIAA0602; PACS1L; PACS-2
UniProt Entry Name
PACS2_HUMAN
Uniprot Description
PACS2: Multifunctional sorting protein that controls the endoplasmic reticulum (ER)-mitochondria communication, including the apposition of mitochondria with the ER and ER homeostasis. In addition, in response to apoptic inducer, translocates BIB to mitochondria, which initiates a sequence of events including the formation of mitochondrial truncated BID, the release of cytochrome c, the activation of caspase-3 thereby causing cell death. May also be involved in ion channel trafficking, directing acidic cluster-containing ion channels to distinct subcellular compartments. Belongs to the PACS family. 3 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 14q32.33
Cellular Component: mitochondrion; endoplasmic reticulum; endoplasmic reticulum lumen
Biological Process: viral reproduction; apoptosis; autophagic vacuole formation
Research Articles on PACS2
Similar Products
Product Notes
The PACS2 pacs2 (Catalog #AAA3210362) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PACS2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PACS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PACS2 pacs2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AHQLPIAEAM LTYKQKSPDE ESSQKFIPFV GVVKVGIVEP SSATSGDSDD. It is sometimes possible for the material contained within the vial of "PACS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
