Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-P2RX7 AntibodyPositive Control: Lane 1: 50ug mock transfected HEK-293Lane 2: 50ug hP2X7 transfected HEK-293Lane 3: 50ug mP2X7 transfected HEK-293Lane 4: 50ug rP2X7 transfected HEK-293Primary Antibody Dilution : 1:625Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Ronald Sluyter, School of Biological Sciences, University of Wollongong)

Rabbit P2RX7 Polyclonal Antibody | anti-P2RX7 antibody

P2RX7 antibody - middle region

Gene Names
P2RX7; P2X7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
P2RX7; Polyclonal Antibody; P2RX7 antibody - middle region; anti-P2RX7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP
Sequence Length
595
Applicable Applications for anti-P2RX7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 83%; Horse: 86%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 93%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human P2RX7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-P2RX7 AntibodyPositive Control: Lane 1: 50ug mock transfected HEK-293Lane 2: 50ug hP2X7 transfected HEK-293Lane 3: 50ug mP2X7 transfected HEK-293Lane 4: 50ug rP2X7 transfected HEK-293Primary Antibody Dilution : 1:625Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Ronald Sluyter, School of Biological Sciences, University of Wollongong)

Western Blot (WB) (WB Suggested Anti-P2RX7 AntibodyPositive Control: Lane 1: 50ug mock transfected HEK-293Lane 2: 50ug hP2X7 transfected HEK-293Lane 3: 50ug mP2X7 transfected HEK-293Lane 4: 50ug rP2X7 transfected HEK-293Primary Antibody Dilution : 1:625Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Ronald Sluyter, School of Biological Sciences, University of Wollongong)

Western Blot (WB)

(WB Suggested Anti-P2RX7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)

Western Blot (WB) (WB Suggested Anti-P2RX7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Related Product Information for anti-P2RX7 antibody
This is a rabbit polyclonal antibody against P2RX7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple alternatively spliced variants which would encode different isoforms have been identified although some fit nonsense-mediated decay (NMD) criteria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
P2X purinoceptor 7
NCBI Official Synonym Full Names
purinergic receptor P2X 7
NCBI Official Symbol
P2RX7
NCBI Official Synonym Symbols
P2X7
NCBI Protein Information
P2X purinoceptor 7
UniProt Protein Name
P2X purinoceptor 7
Protein Family
UniProt Gene Name
P2RX7
UniProt Synonym Gene Names
P2X7
UniProt Entry Name
P2RX7_HUMAN

NCBI Description

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple alternatively spliced variants have been identified, most of which fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq, Jul 2010]

Uniprot Description

P2X7: a receptor for ATP that acts as a ligand-gated ion channel. Responsible for ATP-dependent lysis by macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Alternatively spliced variants encoding different isoforms have been identified. Could function in both fast synaptic transmission and the ATP-mediated lysis of antigen-presenting cells. Phosphorylation results in its inactivation.

Protein type: Receptor, misc.; Membrane protein, integral; Membrane protein, multi-pass; Channel, ligand-gated

Chromosomal Location of Human Ortholog: 12q24

Cellular Component: protein complex; membrane; cell soma; integral to plasma membrane; cytoplasm; plasma membrane; terminal button; integral to nuclear inner membrane; intercellular junction; neuromuscular junction; lipid raft; external side of plasma membrane

Molecular Function: protein binding; protein homodimerization activity; copper ion binding; zinc ion binding; lipopolysaccharide binding; magnesium ion binding; ATP binding; purinergic nucleotide receptor activity; ATP-gated cation channel activity; receptor binding

Biological Process: activation of MAPK activity; positive regulation of T cell mediated cytotoxicity; cytolysis; positive regulation of glutamate secretion; response to lipopolysaccharide; positive regulation of interleukin-1 beta secretion; sensory perception of pain; protein amino acid phosphorylation; positive regulation of interleukin-1 alpha secretion; cell surface receptor linked signal transduction; multicellular organismal protein catabolic process; ceramide biosynthetic process; T cell homeostasis; positive regulation of cytolysis; response to electrical stimulus; positive regulation of gamma-aminobutyric acid secretion; response to drug; mitochondrion organization and biogenesis; collagen metabolic process; positive regulation of interleukin-6 production; positive regulation of cytoskeleton organization and biogenesis; regulation of sodium ion transport; protein oligomerization; phagolysosome formation; phospholipid translocation; membrane depolarization; defense response to Gram-positive bacterium; NAD transport; response to mechanical stimulus; response to zinc ion; cell volume homeostasis; response to calcium ion; phospholipid transfer to membrane; cell morphogenesis; generation of action potential; regulation of killing of cells of another organism; T cell proliferation; plasma membrane organization and biogenesis; positive regulation of mitochondrial depolarization; pore complex biogenesis; inflammatory response; negative regulation of bone resorption; negative regulation of MAPKKK cascade; membrane protein ectodomain proteolysis; bleb formation; positive regulation of bone mineralization; response to ATP; synaptic vesicle exocytosis; skeletal morphogenesis; homeostasis of number of cells within a tissue; release of sequestered calcium ion into cytosol; positive regulation of prostaglandin secretion; cellular response to extracellular stimulus; innate immune response; protein processing; gene expression; membrane budding

Disease: Leukemia, Chronic Lymphocytic

Research Articles on P2RX7

Similar Products

Product Notes

The P2RX7 p2rx7 (Catalog #AAA3202433) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P2RX7 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's P2RX7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the P2RX7 p2rx7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRHCAYRCYA TWRFGSQDMA DFANLPSCCR WRIRKEFPKS EGQYSGFKSP. It is sometimes possible for the material contained within the vial of "P2RX7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.