Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: OTUD1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit OTUD1 Polyclonal Antibody | anti-OTUD1 antibody

OTUD1 Antibody - C-terminal region

Gene Names
OTUD1; DUBA7; OTDC1
Reactivity
Tested: Human
Predicted: Cow, Dog, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OTUD1; Polyclonal Antibody; OTUD1 Antibody - C-terminal region; anti-OTUD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: NGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSMAISLSKMYIEQN
Sequence Length
481
Applicable Applications for anti-OTUD1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OTUD1
Protein Size (#AA)
4/1 amino acids
Blocking peptide
For anti-OTUD1 antibody is (MBS3243736)
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: OTUD1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: OTUD1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: Rabbit)

Western Blot (WB) (Host: Rabbit)
Related Product Information for anti-OTUD1 antibody
This is a rabbit polyclonal antibody against OTUD1. It was validated on Western Blot

Target Description: Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA7 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
Product Categories/Family for anti-OTUD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
OTU domain-containing protein 1
NCBI Official Synonym Full Names
OTU deubiquitinase 1
NCBI Official Symbol
OTUD1
NCBI Official Synonym Symbols
DUBA7; OTDC1
NCBI Protein Information
OTU domain-containing protein 1
UniProt Protein Name
OTU domain-containing protein 1
UniProt Gene Name
OTUD1
UniProt Synonym Gene Names
DUBA7; OTDC1
UniProt Entry Name
OTUD1_HUMAN

NCBI Description

Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA7 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.[supplied by OMIM, May 2008]

Research Articles on OTUD1

Similar Products

Product Notes

The OTUD1 otud1 (Catalog #AAA3218844) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OTUD1 Antibody - C-terminal region reacts with Tested: Human Predicted: Cow, Dog, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OTUD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OTUD1 otud1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NGHYDAVFDH SYPNPEYDNW CKQTQVQRKR DEELAKSMAI SLSKMYIEQN. It is sometimes possible for the material contained within the vial of "OTUD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.