Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-OTUB1 antibody Titration: 1 ug/mLSample Type: Human Hela Whole Cell)

Rabbit anti-Human OTUB1 Polyclonal Antibody | anti-OTUB1 antibody

OTUB1 Antibody - N-terminal region

Gene Names
OTUB1; OTB1; OTU1; HSPC263
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
OTUB1; Polyclonal Antibody; OTUB1 Antibody - N-terminal region; anti-OTUB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEF
Sequence Length
271
Applicable Applications for anti-OTUB1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human OTUB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-OTUB1 antibody Titration: 1 ug/mLSample Type: Human Hela Whole Cell)

Western Blot (WB) (WB Suggested Anti-OTUB1 antibody Titration: 1 ug/mLSample Type: Human Hela Whole Cell)
Related Product Information for anti-OTUB1 antibody
This is a rabbit polyclonal antibody against OTUB1. It was validated on Western Blot

Target Description: The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-OTUB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa
NCBI Official Full Name
ubiquitin thioesterase OTUB1
NCBI Official Synonym Full Names
OTU deubiquitinase, ubiquitin aldehyde binding 1
NCBI Official Symbol
OTUB1
NCBI Official Synonym Symbols
OTB1; OTU1; HSPC263
NCBI Protein Information
ubiquitin thioesterase OTUB1
UniProt Protein Name
Ubiquitin thioesterase OTUB1
Protein Family
UniProt Gene Name
OTUB1
UniProt Synonym Gene Names
OTB1; OTU1; hOTU1
UniProt Entry Name
OTUB1_HUMAN

NCBI Description

The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

OTUB1: a protease that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation. Regulator of T-cell anergy, a phenomenon that occur when T-cell are rendered unresponsive to antigen rechallenge and no longer respond to their cognate antigen. Acts via its interaction with RNF128/GRAIL, a crucial inductor of CD4 T-cell anergy. Two alternatively spliced isoforms are known.

Protein type: Ubiquitin-specific protease; EC 3.4.19.12; Protease; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 11q13.1

Cellular Component: cytoplasm

Molecular Function: protein binding; ubiquitin binding; ubiquitin protein ligase binding; ubiquitin-specific protease activity; NEDD8-specific protease activity

Biological Process: immune system process; proteolysis; DNA repair; response to DNA damage stimulus

Research Articles on OTUB1

Similar Products

Product Notes

The OTUB1 otub1 (Catalog #AAA3214264) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OTUB1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OTUB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OTUB1 otub1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KTRPDGNCFY RAFGFSHLEA LLDDSKELQR FKAVSAKSKE DLVSQGFTEF. It is sometimes possible for the material contained within the vial of "OTUB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.