Rabbit anti-Human, Mouse OSMR Polyclonal Antibody | anti-OSMR antibody

OSMR (Oncostatin-M-specific Receptor Subunit beta, Interleukin-31 Receptor Subunit beta, IL-31 Receptor Subunit beta, IL-31R Subunit beta, IL-31R-beta, IL-31RB, OSMRB) (PE)

Cat. Num. AAA6388106

• Gene Names: OSMR; OSMRB; PLCA1; IL-31RB; OSMRbeta; IL-31R-beta
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: OSMR; Polyclonal Antibody; OSMR (Oncostatin-M-specific Receptor Subunit beta; Interleukin-31 Receptor Subunit beta; IL-31 Receptor Subunit beta; IL-31R Subunit beta; IL-31R-beta; IL-31RB; OSMRB) (PE); anti-OSMR antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human OSMR. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1620

• Applicable Applications for anti-OSMR antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human OSMR, aa1-342 (AAH10943.1)
• Immunogen Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(OSMR rabbit polyclonal antibody. Western Blot analysis of OSMR expression in mouse intestine.)

Western Blot (WB)

(Western Blot analysis of OSMR expression in transfected 293T cell line by OSMR polyclonal antibody. Lane 1: OSMR transfected lysate (39.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between OSMR and ERBB2. HeLa cells were stained with OSMR rabbit purified polyclonal 1:1200 and ERBB2 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-OSMR antibody

Oncostatin M Receptor beta (OSM Rb) is a type I transmembrane protein that binds OSM with low affinity by itself and high affinity as an OSM Rb/gp130 heterodimer. OSM Rb is widely expressed and transduces signals involved in hematopoiesis, liver development, peripheral neuron repair and epithelial cell function. Mature human OSM Rb contains a 712aa extracellular domain (ECD) with one partial and one complete hematopoietin domain, an Ig-like domain and three fibronectin type-III domains, a 22aa transmembrane segment, and a 218aa cytoplasmic domain. Human OSM Rb ECD shares 55% aa sequence identity with mouse OSM Rb.

Product Categories/Family for anti-OSMR antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 15012081
• NCBI GeneID: 9180
• NCBI Official Full Name: Homo sapiens oncostatin M receptor, mRNA
• NCBI Official Synonym Full Names: oncostatin M receptor
• NCBI Official Symbol: OSMR
• NCBI Official Synonym Symbols: OSMRB; PLCA1; IL-31RB; OSMRbeta; IL-31R-beta
• NCBI Protein Information: oncostatin-M-specific receptor subunit beta
• Protein Family: Oncostatin-M-specific receptor

NCBI Description

This gene encodes a member of the type I cytokine receptor family. The encoded protein heterodimerizes with interleukin 6 signal transducer to form the type II oncostatin M receptor and with interleukin 31 receptor A to form the interleukin 31 receptor, and thus transduces oncostatin M and interleukin 31 induced signaling events. Mutations in this gene have been associated with familial primary localized cutaneous amyloidosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]