Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD). )

Mouse anti-Human OSMR Monoclonal Antibody | anti-OSMR antibody

OSMR (Oncostatin-M-specific Receptor Subunit beta, Interleukin-31 Receptor Subunit beta, IL-31 Receptor Subunit beta, IL-31R Subunit beta, IL-31R-beta, IL-31RB, OSMRB) (FITC)

Gene Names
OSMR; OSMRB; PLCA1; IL-31RB; OSMRbeta; IL-31R-beta
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
OSMR; Monoclonal Antibody; OSMR (Oncostatin-M-specific Receptor Subunit beta; Interleukin-31 Receptor Subunit beta; IL-31 Receptor Subunit beta; IL-31R Subunit beta; IL-31R-beta; IL-31RB; OSMRB) (FITC); anti-OSMR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E12
Specificity
Recognizes human OSMR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
5526
Applicable Applications for anti-OSMR antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa141-241 from OSMR (NP_003990) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD). )

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD). )

Western Blot (WB)

(Western Blot analysis of OSMR expression in transfected 293T cell line by OSMR monoclonal antibody Lane 1: OSMR transfected lysate (39.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of OSMR expression in transfected 293T cell line by OSMR monoclonal antibody Lane 1: OSMR transfected lysate (39.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-OSMR antibody
Oncostatin M Receptor beta (OSM Rb) is a type I transmembrane protein that binds OSM with low affinity by itself and high affinity as an OSM Rb/gp130 heterodimer. OSM Rb is widely expressed and transduces signals involved in hematopoiesis, liver development, peripheral neuron repair and epithelial cell function. Mature human OSM Rb contains a 712aa extracellular domain (ECD) with one partial and one complete hematopoietin domain, an Ig-like domain and three fibronectin type-III domains, a 22aa transmembrane segment, and a 218aa cytoplasmic domain. Human OSM Rb ECD shares 55% aa sequence identity with mouse OSM Rb.
Product Categories/Family for anti-OSMR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens oncostatin M receptor (OSMR), transcript variant 1, mRNA
NCBI Official Synonym Full Names
oncostatin M receptor
NCBI Official Symbol
OSMR
NCBI Official Synonym Symbols
OSMRB; PLCA1; IL-31RB; OSMRbeta; IL-31R-beta
NCBI Protein Information
oncostatin-M-specific receptor subunit beta
UniProt Protein Name
Oncostatin-M-specific receptor subunit beta
UniProt Gene Name
OSMR
UniProt Synonym Gene Names
OSMRB; IL-31 receptor subunit beta; IL-31R subunit beta; IL-31R-beta; IL-31RB

NCBI Description

This gene encodes a member of the type I cytokine receptor family. The encoded protein heterodimerizes with interleukin 6 signal transducer to form the type II oncostatin M receptor and with interleukin 31 receptor A to form the interleukin 31 receptor, and thus transduces oncostatin M and interleukin 31 induced signaling events. Mutations in this gene have been associated with familial primary localized cutaneous amyloidosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]

Uniprot Description

Associates with IL31RA to form the IL31 receptor. Binds IL31 to activate STAT3 and possibly STAT1 and STAT5. Capable of transducing OSM-specific signaling events.

Research Articles on OSMR

Similar Products

Product Notes

The OSMR osmr (Catalog #AAA6148628) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The OSMR (Oncostatin-M-specific Receptor Subunit beta, Interleukin-31 Receptor Subunit beta, IL-31 Receptor Subunit beta, IL-31R Subunit beta, IL-31R-beta, IL-31RB, OSMRB) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OSMR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OSMR osmr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OSMR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.