Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (OSMR rabbit polyclonal antibody. Western Blot analysis of OSMR expression in mouse intestine.)

Rabbit anti-Human, Mouse OSMR Polyclonal Antibody | anti-OSMR antibody

OSMR (Oncostatin-M-specific Receptor Subunit beta, Interleukin-31 Receptor Subunit beta, IL-31 Receptor Subunit beta, IL-31R Subunit beta, IL-31R-beta, IL-31RB, OSMRB) (HRP)

Gene Names
OSMR; OSMRB; PLCA1; IL-31RB; OSMRbeta; IL-31R-beta
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
OSMR; Polyclonal Antibody; OSMR (Oncostatin-M-specific Receptor Subunit beta; Interleukin-31 Receptor Subunit beta; IL-31 Receptor Subunit beta; IL-31R Subunit beta; IL-31R-beta; IL-31RB; OSMRB) (HRP); anti-OSMR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human OSMR. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
1620
Applicable Applications for anti-OSMR antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human OSMR, aa1-342 (AAH10943.1)
Immunogen Sequence
MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(OSMR rabbit polyclonal antibody. Western Blot analysis of OSMR expression in mouse intestine.)

Western Blot (WB) (OSMR rabbit polyclonal antibody. Western Blot analysis of OSMR expression in mouse intestine.)

Western Blot (WB)

(Western Blot analysis of OSMR expression in transfected 293T cell line by OSMR polyclonal antibody. Lane 1: OSMR transfected lysate (39.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of OSMR expression in transfected 293T cell line by OSMR polyclonal antibody. Lane 1: OSMR transfected lysate (39.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between OSMR and ERBB2. HeLa cells were stained with OSMR rabbit purified polyclonal 1:1200 and ERBB2 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between OSMR and ERBB2. HeLa cells were stained with OSMR rabbit purified polyclonal 1:1200 and ERBB2 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-OSMR antibody
Oncostatin M Receptor beta (OSM Rb) is a type I transmembrane protein that binds OSM with low affinity by itself and high affinity as an OSM Rb/gp130 heterodimer. OSM Rb is widely expressed and transduces signals involved in hematopoiesis, liver development, peripheral neuron repair and epithelial cell function. Mature human OSM Rb contains a 712aa extracellular domain (ECD) with one partial and one complete hematopoietin domain, an Ig-like domain and three fibronectin type-III domains, a 22aa transmembrane segment, and a 218aa cytoplasmic domain. Human OSM Rb ECD shares 55% aa sequence identity with mouse OSM Rb.
Product Categories/Family for anti-OSMR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens oncostatin M receptor, mRNA
NCBI Official Synonym Full Names
oncostatin M receptor
NCBI Official Symbol
OSMR
NCBI Official Synonym Symbols
OSMRB; PLCA1; IL-31RB; OSMRbeta; IL-31R-beta
NCBI Protein Information
oncostatin-M-specific receptor subunit beta

NCBI Description

This gene encodes a member of the type I cytokine receptor family. The encoded protein heterodimerizes with interleukin 6 signal transducer to form the type II oncostatin M receptor and with interleukin 31 receptor A to form the interleukin 31 receptor, and thus transduces oncostatin M and interleukin 31 induced signaling events. Mutations in this gene have been associated with familial primary localized cutaneous amyloidosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]

Research Articles on OSMR

Similar Products

Product Notes

The OSMR (Catalog #AAA6388100) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OSMR (Oncostatin-M-specific Receptor Subunit beta, Interleukin-31 Receptor Subunit beta, IL-31 Receptor Subunit beta, IL-31R Subunit beta, IL-31R-beta, IL-31RB, OSMRB) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's OSMR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OSMR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OSMR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.