Western Blot (WB)
(WB Suggested Anti-ORAI3 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Rabbit ORAI3 Polyclonal Antibody | anti-ORAI3 antibody
ORAI3 Antibody - N-terminal region
Gene Names
ORAI3; TMEM142C
Reactivity
Tested:HumanPredicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ORAI3; Polyclonal Antibody; ORAI3 Antibody - N-terminal region; anti-ORAI3 antibody
Host
Rabbit
Reactivity
Tested:Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5- 1mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLY
Sequence Length
295
Applicable Applications for anti-ORAI3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ORAI3
Protein Size
295 amino acids
Protein Interactions
UBC
Blocking Peptide
For anti-ORAI3 (MBS3216394) antibody is MBS3241294.
Replacement Item
This anibody may replace item sc-292104 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ORAI3 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Western Blot (WB)
(WB Suggested Anti-ORAI3 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-ORAI3 antibody
This is a rabbit polyclonal antibody against ORAI3. It was validated on Western Blot
Target Description: ORAI3 is a key regulator or component of store-operated Ca2+ channel and transcription factor NFAT nuclear import.
Target Description: ORAI3 is a key regulator or component of store-operated Ca2+ channel and transcription factor NFAT nuclear import.
Product Categories/Family for anti-ORAI3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
protein orai-3
NCBI Official Synonym Full Names
ORAI calcium release-activated calcium modulator 3
NCBI Official Symbol
ORAI3
NCBI Official Synonym Symbols
TMEM142C
NCBI Protein Information
protein orai-3
UniProt Protein Name
Protein orai-3
Protein Family
UniProt Gene Name
ORAI3
UniProt Synonym Gene Names
TMEM142C
UniProt Entry Name
ORAI3_HUMAN
Uniprot Description
TMEM142C: Key regulator or component of store-operated Ca(2+) channel and transcription factor NFAT nuclear import. Belongs to the Orai family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 16p11.2
Cellular Component: integral to membrane
Molecular Function: protein binding
Research Articles on ORAI3
Similar Products
Product Notes
The ORAI3 orai3 (Catalog #AAA3216394) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ORAI3 Antibody - N-terminal region reacts with Tested:Human Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ORAI3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ORAI3 orai3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GDAGEQAPLN PEGESPAGSA TYREFVHRGY LDLMGASQHS LRALSWRRLY. It is sometimes possible for the material contained within the vial of "ORAI3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
