Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-OPN1SW Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysateOPN1SW is supported by BioGPS gene expression data to be expressed in A549)

Rabbit OPN1SW Polyclonal Antibody | anti-OPN1SW antibody

OPN1SW antibody - C-terminal region

Gene Names
OPN1SW; BCP; BOP; CBT
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OPN1SW; Polyclonal Antibody; OPN1SW antibody - C-terminal region; anti-OPN1SW antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAERE
Sequence Length
348
Applicable Applications for anti-OPN1SW antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human OPN1SW
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-OPN1SW Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysateOPN1SW is supported by BioGPS gene expression data to be expressed in A549)

Western Blot (WB) (WB Suggested Anti-OPN1SW Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysateOPN1SW is supported by BioGPS gene expression data to be expressed in A549)
Related Product Information for anti-OPN1SW antibody
This is a rabbit polyclonal antibody against OPN1SW. It was validated on Western Blot

Target Description: This gene belongs to the G-protein coupled receptor 1 family, opsin subfamily. It encodes the blue cone pigment gene which is one of three types of cone photoreceptors responsible for normal color vision. Defects in this gene are the cause of tritan color blindness (tritanopia). Affected individuals lack blue and yellow sensory mechanisms while retaining those for red and green. Defective blue vision is characteristic.
Product Categories/Family for anti-OPN1SW antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
611
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
short-wave-sensitive opsin 1
NCBI Official Synonym Full Names
opsin 1, short wave sensitive
NCBI Official Symbol
OPN1SW
NCBI Official Synonym Symbols
BCP; BOP; CBT
NCBI Protein Information
short-wave-sensitive opsin 1
UniProt Protein Name
Short-wave-sensitive opsin 1
UniProt Gene Name
OPN1SW
UniProt Synonym Gene Names
BCP; BOP
UniProt Entry Name
OPSB_HUMAN

NCBI Description

This gene belongs to the G-protein coupled receptor 1 family, opsin subfamily. It encodes the blue cone pigment gene which is one of three types of cone photoreceptors responsible for normal color vision. Defects in this gene are the cause of tritan color blindness (tritanopia). Affected individuals lack blue and yellow sensory mechanisms while retaining those for red and green. Defective blue vision is characteristic. [provided by RefSeq, Jul 2008]

Uniprot Description

OPN1SW: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. Defects in OPN1SW are the cause of tritan color blindness (CBT). Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 7q32.1

Cellular Component: integral to plasma membrane

Molecular Function: G-protein coupled receptor activity; photoreceptor activity; receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; phototransduction, visible light; visual perception; phototransduction; retinoid metabolic process; signal transduction; protein-chromophore linkage

Disease: Tritanopia

Research Articles on OPN1SW

Similar Products

Product Notes

The OPN1SW opn1sw (Catalog #AAA3214564) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OPN1SW antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OPN1SW can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OPN1SW opn1sw for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SESYTWFLFI FCFIVPLSLI CFSYTQLLRA LKAVAAQQQE SATTQKAERE. It is sometimes possible for the material contained within the vial of "OPN1SW, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.