Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Human Brain, cerebellum tissue at an antibody concentration of 5.0ug/ml using anti-ONECUT1 antibody )

Rabbit ONECUT1 Polyclonal Antibody | anti-ONECUT1 antibody

ONECUT1 antibody - middle region

Gene Names
ONECUT1; HNF6; HNF-6; HNF6A
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ONECUT1; Polyclonal Antibody; ONECUT1 antibody - middle region; anti-ONECUT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
Sequence Length
465
Applicable Applications for anti-ONECUT1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ONECUT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Human Brain, cerebellum tissue at an antibody concentration of 5.0ug/ml using anti-ONECUT1 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Human Brain, cerebellum tissue at an antibody concentration of 5.0ug/ml using anti-ONECUT1 antibody )

Western Blot (WB)

(WB Suggested Anti-ONECUT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ONECUT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-ONECUT1 antibody
This is a rabbit polyclonal antibody against ONECUT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ONECUT1 belongs to the CUT homeobox family. It contains 1 CUT DNA-binding domain and 1 homeobox DNA-binding domain. It is a transcriptional activator. ONECUT1 binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. It is important for liver genes transcription.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
hepatocyte nuclear factor 6
NCBI Official Synonym Full Names
one cut homeobox 1
NCBI Official Symbol
ONECUT1
NCBI Official Synonym Symbols
HNF6; HNF-6; HNF6A
NCBI Protein Information
hepatocyte nuclear factor 6
UniProt Protein Name
Hepatocyte nuclear factor 6
Protein Family
UniProt Gene Name
ONECUT1
UniProt Synonym Gene Names
HNF6; HNF6A; HNF-6
UniProt Entry Name
HNF6_HUMAN

NCBI Description

This gene encodes a member of the Cut homeobox family of transcription factors. Expression of the encoded protein is enriched in the liver, where it stimulates transcription of liver-expressed genes, and antagonizes glucocorticoid-stimulated gene transcription. This gene may influence a variety of cellular processes including glucose metabolism, cell cycle regulation, and it may also be associated with cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]

Uniprot Description

ONECUT1: Transcriptional activator. Binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. Important for liver genes transcription. Belongs to the CUT homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 15q21.3

Cellular Component: nucleus

Molecular Function: DNA binding

Biological Process: spleen development; cell fate commitment; transcription, DNA-dependent; regulation of cell-matrix adhesion; system development; glucose metabolic process; liver development; endocrine pancreas development; regulation of transcription, DNA-dependent; B cell differentiation; epithelial cell development; cilium biogenesis; positive regulation of transcription from RNA polymerase II promoter; cell differentiation; negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of cell migration; endoderm development

Research Articles on ONECUT1

Similar Products

Product Notes

The ONECUT1 onecut1 (Catalog #AAA3204101) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ONECUT1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ONECUT1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ONECUT1 onecut1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITISQQLGLE LSTVSNFFMN ARRRSLDKWQ DEGSSNSGNS SSSSSTCTKA. It is sometimes possible for the material contained within the vial of "ONECUT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.