Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of OSM expression in transfected 293T cell line by OSM polyclonal antibody. Lane 1: OSM transfected lysate (28.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Oncostatin M Polyclonal Antibody | anti-OSM antibody

Oncostatin M (OSM, Oncostatin-M, MGC20461) (AP)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Oncostatin M; Polyclonal Antibody; Oncostatin M (OSM; Oncostatin-M; MGC20461) (AP); anti-OSM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human OSM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-OSM antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human OSM, aa1-252 (NP_065391.1).
Immunogen Sequence
MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of OSM expression in transfected 293T cell line by OSM polyclonal antibody. Lane 1: OSM transfected lysate (28.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of OSM expression in transfected 293T cell line by OSM polyclonal antibody. Lane 1: OSM transfected lysate (28.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between OSM and COL4A6. HeLa cells were stained with OSM rabbit purified polyclonal 1:1200 and COL4A6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between OSM and COL4A6. HeLa cells were stained with OSM rabbit purified polyclonal 1:1200 and COL4A6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Product Categories/Family for anti-OSM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,484 Da
NCBI Official Full Name
oncostatin-M preproprotein
NCBI Official Synonym Full Names
oncostatin M
NCBI Official Symbol
OSM
NCBI Protein Information
oncostatin-M
UniProt Protein Name
Oncostatin-M
Protein Family
UniProt Gene Name
OSM
UniProt Synonym Gene Names
OSM
UniProt Entry Name
ONCM_HUMAN

NCBI Description

Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. [provided by RefSeq, Jul 2008]

Uniprot Description

OSM: Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration. Belongs to the LIF/OSM family.

Protein type: Secreted, signal peptide; Cytokine; Secreted

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: extracellular space

Molecular Function: growth factor activity; oncostatin-M receptor binding; cytokine activity

Biological Process: multicellular organismal development; negative regulation of hormone secretion; tyrosine phosphorylation of Stat3 protein; tyrosine phosphorylation of Stat5 protein; positive regulation of peptidyl-serine phosphorylation; peripheral nervous system development; cell proliferation; negative regulation of cell proliferation; positive regulation of peptidyl-tyrosine phosphorylation; behavioral response to pain; positive regulation of MAPKKK cascade; response to heat; positive regulation of acute inflammatory response; regulation of growth; positive regulation of cell division; negative regulation of meiosis; positive regulation of cell proliferation; tyrosine phosphorylation of Stat1 protein; positive regulation of transcription from RNA polymerase II promoter; immune response

Research Articles on OSM

Similar Products

Product Notes

The OSM osm (Catalog #AAA6388019) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Oncostatin M (OSM, Oncostatin-M, MGC20461) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Oncostatin M can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OSM osm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Oncostatin M, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.