Western Blot (WB)
(Host: RabbitTarget Name: C4orf26Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human ODAPH Polyclonal Antibody | anti-ODAPH antibody
ODAPH Antibody - N-terminal region
Gene Names
ODAPH; AI2A4; C4orf26
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ODAPH; Polyclonal Antibody; ODAPH Antibody - N-terminal region; anti-ODAPH antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTP
Sequence Length
130
Applicable Applications for anti-ODAPH antibody
Western Blot (WB)
Homology
Human: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C4orf26
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: C4orf26Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: C4orf26Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ODAPH antibody
This is a rabbit polyclonal antibody against C4orf26. It was validated on Western Blot
Target Description: Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene is thought to encode an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis. Mutations in this gene are associated with recessive hypomineralized amelogenesis imperfecta.
Target Description: Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene is thought to encode an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis. Mutations in this gene are associated with recessive hypomineralized amelogenesis imperfecta.
Product Categories/Family for anti-ODAPH antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
odontogenesis associated phosphoprotein isoform 2
NCBI Official Synonym Full Names
odontogenesis associated phosphoprotein
NCBI Official Symbol
ODAPH
NCBI Official Synonym Symbols
AI2A4; C4orf26
NCBI Protein Information
odontogenesis associated phosphoprotein
UniProt Protein Name
Uncharacterized protein C4orf26
UniProt Gene Name
C4orf26
UniProt Entry Name
CD026_HUMAN
NCBI Description
Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene is thought to encode an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis. Mutations in this gene are associated with recessive hypomineralized amelogenesis imperfecta. [provided by RefSeq, Oct 2012]
Research Articles on ODAPH
Similar Products
Product Notes
The ODAPH c4orf26 (Catalog #AAA3218177) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ODAPH Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ODAPH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ODAPH c4orf26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MARRHCFSYW LLVCWLVVTV AEGQEEVFTP PGDSQNNADA TDCQIFTLTP. It is sometimes possible for the material contained within the vial of "ODAPH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
