Western Blot (WB)
(Host: RabbitTarget Name: AMELYAntibody Dilution: 1.0ug/mlSample Type: Human Thymus)
Rabbit AMELY Polyclonal Antibody | anti-AMELY antibody
AMELY antibody - C-terminal region
Gene Names
AMELY; AMGL; AMGY
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AMELY; Polyclonal Antibody; AMELY antibody - C-terminal region; anti-AMELY antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQ
Sequence Length
192
Applicable Applications for anti-AMELY antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 85%; Goat: 85%; Horse: 85%; Human: 100%; Mouse: 77%; Pig: 92%; Rat: 85%; Sheep: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: AMELYAntibody Dilution: 1.0ug/mlSample Type: Human Thymus)
Western Blot (WB)
(Host: RabbitTarget Name: AMELYAntibody Dilution: 1.0ug/mlSample Type: Human Thymus)
Related Product Information for anti-AMELY antibody
This is a rabbit polyclonal antibody against AMELY. It was validated on Western Blot
Target Description: This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta.
Target Description: This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta.
Product Categories/Family for anti-AMELY antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
amelogenin, Y isoform isoform 1
NCBI Official Synonym Full Names
amelogenin Y-linked
NCBI Official Symbol
AMELY
NCBI Official Synonym Symbols
AMGL; AMGY
NCBI Protein Information
amelogenin, Y isoform
UniProt Protein Name
Amelogenin, Y isoform
Protein Family
UniProt Gene Name
AMELY
UniProt Synonym Gene Names
AMGL; AMGY
NCBI Description
This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta. [provided by RefSeq, Jul 2008]
Uniprot Description
Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.
Research Articles on AMELY
Similar Products
Product Notes
The AMELY amely (Catalog #AAA3211737) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMELY antibody - C-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's AMELY can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AMELY amely for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QPMQPQPPVQ PMQPLLPQPP LPPMFPLRPL PPILPDLHLE AWPATDKTKQ. It is sometimes possible for the material contained within the vial of "AMELY, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
