Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PRSS56Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PRSS56 Polyclonal Antibody | anti-PRSS56 antibody

PRSS56 Antibody - N-terminal region

Gene Names
PRSS56; MCOP6
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRSS56; Polyclonal Antibody; PRSS56 Antibody - N-terminal region; anti-PRSS56 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLSFLRLSCRSTRSAPNELLWTVTLAEGSRGEQAEEVPVNRILPHPKFDP
Sequence Length
603
Applicable Applications for anti-PRSS56 antibody
Western Blot (WB)
Homology
Dog: 93%; Human: 100%; Mouse: 85%; Pig: 86%; Rabbit: 93%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRSS56
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PRSS56Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PRSS56Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PRSS56 antibody
This is a rabbit polyclonal antibody against PRSS56. It was validated on Western Blot

Target Description: This gene encodes a protein that contains a peptidase S1 domain and possesses trypsin-like serine protease activity. The encoded protein may play a role in eye development, and mutations in this gene are a cause of autosomal recessive posterior microphthalmos.
Product Categories/Family for anti-PRSS56 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
hCG1818432, isoform CRA_b
NCBI Official Synonym Full Names
serine protease 56
NCBI Official Symbol
PRSS56
NCBI Official Synonym Symbols
MCOP6
NCBI Protein Information
serine protease 56
UniProt Protein Name
Serine protease 56
Protein Family
UniProt Gene Name
PRSS56

NCBI Description

This gene encodes a protein that contains a peptidase S1 domain and possesses trypsin-like serine protease activity. The encoded protein may play a role in eye development, and mutations in this gene are a cause of autosomal recessive posterior microphthalmos. [provided by RefSeq, Dec 2011]

Uniprot Description

Serine protease required during eye development.

Research Articles on PRSS56

Similar Products

Product Notes

The PRSS56 prss56 (Catalog #AAA3218340) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRSS56 Antibody - N-terminal region reacts with Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRSS56 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRSS56 prss56 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLSFLRLSCR STRSAPNELL WTVTLAEGSR GEQAEEVPVN RILPHPKFDP. It is sometimes possible for the material contained within the vial of "PRSS56, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.