Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Oaz1Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Mouse OAZ1 Polyclonal Antibody | anti-OAZ1 antibody

OAZ1 Antibody - middle region

Gene Names
Oaz1; AZ1; Oaz; AZ-1; ODC-Az; Antizyme
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
OAZ1; Polyclonal Antibody; OAZ1 Antibody - middle region; anti-OAZ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: PHPPLKIPGGRGNSQRDHSLSASILYSDERLNVTEEPTSNDKTRVLSIQS
Sequence Length
227
Applicable Applications for anti-OAZ1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of rat OAZ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Oaz1Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Oaz1Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-OAZ1 antibody
The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamines. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis; thus, completing the auto-regulatory circuit. This gene encodes antizyme 1, the first member of the antizyme family, that has broad tissue distribution, and negatively regulates intracellular polyamine levels by binding to and targeting ODC for degradation, as well as inhibiting polyamine uptake. Antizyme 1 mRNA contains two potential in-frame AUGs; and studies in rat suggest that alternative use of the two translation initiation sites results in N-terminally distinct protein isoforms with different subcellular localization. Alternatively spliced transcript variants have also been noted for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
ornithine decarboxylase antizyme 1 isoform 1
NCBI Official Synonym Full Names
ornithine decarboxylase antizyme 1
NCBI Official Symbol
Oaz1
NCBI Official Synonym Symbols
AZ1; Oaz; AZ-1; ODC-Az; Antizyme
NCBI Protein Information
ornithine decarboxylase antizyme 1
UniProt Protein Name
Ornithine decarboxylase antizyme 1
UniProt Gene Name
Oaz1
UniProt Synonym Gene Names
Oaz; ODC-Az
UniProt Entry Name
OAZ1_MOUSE

NCBI Description

The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamines. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis; thus, completing the auto-regulatory circuit. This gene encodes antizyme 1, the first member of the antizyme family, that has broad tissue distribution, and negatively regulates intracellular polyamine levels by binding to and targeting ODC for degradation, as well as inhibiting polyamine uptake. Antizyme 1 mRNA contains two potential in-frame AUGs; and studies in rat suggest that alternative use of the two translation initiation sites results in N-terminally distinct protein isoforms with different subcellular localization. Alternatively spliced transcript variants have also been noted for this gene. [provided by RefSeq, Dec 2014]

Uniprot Description

OAZ1: Binds to, and destabilizes, ornithine decarboxylase which is then degraded. Also inhibits cellular uptake of polyamines by inactivating the polyamine uptake transporter. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. Belongs to the ODC antizyme family. 1 isoforms of the human protein are produced by ribosomal frameshifting.

Protein type: Inhibitor

Cellular Component: cytosol

Molecular Function: enzyme inhibitor activity; protein binding; enzyme binding; protein heterodimerization activity; ornithine decarboxylase inhibitor activity

Biological Process: transport; polyamine biosynthetic process; negative regulation of catalytic activity; positive regulation of protein catabolic process; polyamine metabolic process

Research Articles on OAZ1

Similar Products

Product Notes

The OAZ1 oaz1 (Catalog #AAA3220344) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OAZ1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's OAZ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OAZ1 oaz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PHPPLKIPGG RGNSQRDHSL SASILYSDER LNVTEEPTSN DKTRVLSIQS. It is sometimes possible for the material contained within the vial of "OAZ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.