Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human IL15RA Monoclonal Antibody | anti-IL15RA antibody

IL15RA (Interleukin-15 Receptor Subunit alpha, IL-15 Receptor Subunit alpha, IL-15R-alpha, IL-15RA, CD215, Soluble Interleukin-15 Receptor Subunit alpha, sIL-15 Receptor Subunit alpha, sIL-15R-alpha, sIL-15RA, MGC104179) (HRP)

Gene Names
IL15RA; CD215
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL15RA; Monoclonal Antibody; IL15RA (Interleukin-15 Receptor Subunit alpha; IL-15 Receptor Subunit alpha; IL-15R-alpha; IL-15RA; CD215; Soluble Interleukin-15 Receptor Subunit alpha; sIL-15 Receptor Subunit alpha; sIL-15R-alpha; sIL-15RA; MGC104179) (HRP); anti-IL15RA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1C5
Specificity
Recognizes human IL15RA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-IL15RA antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa31-130 from human IL15RA (NP_002180) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged IL15RA is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IL15RA is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-IL15RA antibody
This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported.
Product Categories/Family for anti-IL15RA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45.6kDa (417aa) 57-70KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
interleukin-15 receptor subunit alpha isoform 1
NCBI Official Synonym Full Names
interleukin 15 receptor subunit alpha
NCBI Official Symbol
IL15RA
NCBI Official Synonym Symbols
CD215
NCBI Protein Information
interleukin-15 receptor subunit alpha
UniProt Protein Name
Interleukin-15 receptor subunit alpha
Protein Family
UniProt Gene Name
IL15RA
UniProt Synonym Gene Names
IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA
UniProt Entry Name
I15RA_HUMAN

NCBI Description

This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported.[provided by RefSeq, Apr 2010]

Uniprot Description

IL15RA: High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 and SYK. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 10p15.1

Cellular Component: Golgi membrane; extracellular space; endoplasmic reticulum membrane; nuclear membrane; cytoplasmic vesicle membrane; integral to membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; signal transducer activity; protein binding

Biological Process: cell proliferation; cytokine and chemokine mediated signaling pathway; signal transduction

Research Articles on IL15RA

Similar Products

Product Notes

The IL15RA il15ra (Catalog #AAA6153055) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL15RA (Interleukin-15 Receptor Subunit alpha, IL-15 Receptor Subunit alpha, IL-15R-alpha, IL-15RA, CD215, Soluble Interleukin-15 Receptor Subunit alpha, sIL-15 Receptor Subunit alpha, sIL-15R-alpha, sIL-15RA, MGC104179) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL15RA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL15RA il15ra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL15RA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.