Western Blot (WB)
(WB Suggested Anti-NXNL1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Rabbit NXNL1 Polyclonal Antibody | anti-NXNL1 antibody
NXNL1 Antibody - C-terminal region
Gene Names
NXNL1; RDCVF; TXNL6
Reactivity
Cow, Dog, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NXNL1; Polyclonal Antibody; NXNL1 Antibody - C-terminal region; anti-NXNL1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAG
Sequence Length
212
Applicable Applications for anti-NXNL1 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Human: 100%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NXNL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-NXNL1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Western Blot (WB)
(WB Suggested Anti-NXNL1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Related Product Information for anti-NXNL1 antibody
This is a rabbit polyclonal antibody against NXNL1. It was validated on Western Blot
Target Description: NXNL1 may play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods.
Target Description: NXNL1 may play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods.
Product Categories/Family for anti-NXNL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
nucleoredoxin-like protein 1
NCBI Official Synonym Full Names
nucleoredoxin like 1
NCBI Official Symbol
NXNL1
NCBI Official Synonym Symbols
RDCVF; TXNL6
NCBI Protein Information
nucleoredoxin-like protein 1
UniProt Protein Name
Nucleoredoxin-like protein 1
Protein Family
UniProt Gene Name
NXNL1
UniProt Synonym Gene Names
TXNL6
UniProt Entry Name
NXNL1_HUMAN
NCBI Description
Retinitis pigmentosa (RP) is a disease that leads to blindness by degeneration of cone photoreceptors. Rods produce factors required for cone viability. The protein encoded by this gene is one of those factors and is similar to a truncated form of thioredoxin. This gene has been proposed to have therapeutic value against RP. [provided by RefSeq, Dec 2015]
Research Articles on NXNL1
Similar Products
Product Notes
The NXNL1 nxnl1 (Catalog #AAA3216752) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NXNL1 Antibody - C-terminal region reacts with Cow, Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's NXNL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NXNL1 nxnl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DRNFQLPEDL EDQEPRSLTE CLRRHKYRVE KAARGGRDPG GGGGEEGGAG. It is sometimes possible for the material contained within the vial of "NXNL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
