Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human NXNL1 Monoclonal Antibody | anti-NXNL1 antibody

NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (PE)

Gene Names
NXNL1; RDCVF; TXNL6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NXNL1; Monoclonal Antibody; NXNL1 (TXNL6; Nucleoredoxin-like Protein 1; Thioredoxin-like Protein 6; RDCVF) (PE); anti-NXNL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
7H3
Specificity
Recognizes human TXNL6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NXNL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa81-191 from human TXNL6 (NP_612463) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(Western Blot analysis of TXNL6 expression in transfected 293T cell line by TXNL6 monoclonal antibody. Lane 1: TXNL6 transfected lysate (23.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TXNL6 expression in transfected 293T cell line by TXNL6 monoclonal antibody. Lane 1: TXNL6 transfected lysate (23.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NXNL1 antibody
NXNL1 may play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods (By similarity).
Product Categories/Family for anti-NXNL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
nucleoredoxin-like protein 1
NCBI Official Synonym Full Names
nucleoredoxin like 1
NCBI Official Symbol
NXNL1
NCBI Official Synonym Symbols
RDCVF; TXNL6
NCBI Protein Information
nucleoredoxin-like protein 1
UniProt Protein Name
Nucleoredoxin-like protein 1
UniProt Gene Name
NXNL1
UniProt Synonym Gene Names
TXNL6
UniProt Entry Name
NXNL1_HUMAN

NCBI Description

Retinitis pigmentosa (RP) is a disease that leads to blindness by degeneration of cone photoreceptors. Rods produce factors required for cone viability. The protein encoded by this gene is one of those factors and is similar to a truncated form of thioredoxin. This gene has been proposed to have therapeutic value against RP. [provided by RefSeq, Dec 2015]

Research Articles on NXNL1

Similar Products

Product Notes

The NXNL1 nxnl1 (Catalog #AAA6160913) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NXNL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NXNL1 nxnl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NXNL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.