Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using NUDT16 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Rabbit anti-Human, Mouse NUDT16 Polyclonal Antibody | anti-NUDT16 antibody

NUDT16 Rabbit pAb

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
NUDT16; Polyclonal Antibody; NUDT16 Rabbit pAb; anti-NUDT16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
GFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRA
Applicable Applications for anti-NUDT16 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 60-130 of human NUDT16 (NP_689608.2).
Positive Samples
293T, A-549
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using NUDT16 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using NUDT16 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,259 Da
NCBI Official Full Name
U8 snoRNA-decapping enzyme isoform 3
NCBI Official Synonym Full Names
nudix (nucleoside diphosphate linked moiety X)-type motif 16
NCBI Official Symbol
NUDT16
NCBI Protein Information
U8 snoRNA-decapping enzyme; IDP phosphatase; IDPase; U8 snoRNA-binding protein H29K; inosine diphosphate phosphatase; m7GpppN-mRNA hydrolase; nucleoside diphosphate-linked moiety X motif 16; nudix motif 16
UniProt Protein Name
U8 snoRNA-decapping enzyme
Protein Family
UniProt Gene Name
NUDT16
UniProt Synonym Gene Names
IDPase; Nudix motif 16
UniProt Entry Name
NUD16_HUMAN

Uniprot Description

NUDT16: RNA-decapping enzyme that binds specifically to U8 snoRNA. Part of the U8 snoRNP complex that is required for the accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and m227G caps from U8 snoRNA. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species (in vitro). Belongs to the Nudix hydrolase family.

Protein type: Hydrolase; Nucleolus; EC 3.6.1.62

Chromosomal Location of Human Ortholog: 3q22.1

Cellular Component: nucleoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: mRNA binding; snoRNA binding; m7G(5')pppN diphosphatase activity; protein homodimerization activity; GTP binding; metalloexopeptidase activity; manganese ion binding; magnesium ion binding; cobalt ion binding

Biological Process: snoRNA catabolic process; dephosphorylation; nucleobase, nucleoside and nucleotide metabolic process; positive regulation of cell proliferation; mRNA catabolic process; proteolysis; adenosine to inosine editing; IDP catabolic process

Research Articles on NUDT16

Similar Products

Product Notes

The NUDT16 nudt16 (Catalog #AAA9143047) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDT16 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the NUDT16 nudt16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GFVDTQDRSL EDGLNRELRE ELGEAAAAFR VERTDYRSSH VGSGPRVVAH FYAKRLTLEE LLAVEAGATR A. It is sometimes possible for the material contained within the vial of "NUDT16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.