Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human NUDT1 Polyclonal Antibody | anti-NUDT1 antibody

NUDT1 (7,8-dihydro-8-oxoguanine Triphosphatase, 2-hydroxy-dATP Diphosphatase, 8-oxo-dGTPase, Nucleoside Diphosphate-linked Moiety X Motif 1, Nudix Motif 1, MTH1) (MaxLight 650)

Gene Names
NUDT1; MTH1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NUDT1; Polyclonal Antibody; NUDT1 (7; 8-dihydro-8-oxoguanine Triphosphatase; 2-hydroxy-dATP Diphosphatase; 8-oxo-dGTPase; Nucleoside Diphosphate-linked Moiety X Motif 1; Nudix Motif 1; MTH1) (MaxLight 650); anti-NUDT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NUDT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-NUDT1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NUDT1, aa1-156 (NP_002443.3).
Immunogen Sequence
MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NUDT1 antibody
MTH1 converts 8-oxo-dGTP in the nucleotide pool to the monophosphate and prevents the misincorporation of 8-oxo-dGTP into DNA. MTH1 also recognizes 8-oxo-rGTP, which could incorporate into RNA during gene transcription leading to missense or nonsense protein production.
Product Categories/Family for anti-NUDT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,952 Da
NCBI Official Full Name
7,8-dihydro-8-oxoguanine triphosphatase isoform p18
NCBI Official Synonym Full Names
nudix (nucleoside diphosphate linked moiety X)-type motif 1
NCBI Official Symbol
NUDT1
NCBI Official Synonym Symbols
MTH1
NCBI Protein Information
7,8-dihydro-8-oxoguanine triphosphatase; 2-hydroxy-dATP diphosphatase; 8-oxo-7,8-dihydrodeoxyguanosine triphosphatase; 8-oxo-7,8-dihydroguanosine triphosphatase; 8-oxo-dGTPase; mutT human homolog 1; nucleoside diphosphate-linked moiety X motif 1; nucleosi
UniProt Protein Name
7,8-dihydro-8-oxoguanine triphosphatase
Protein Family
UniProt Gene Name
NUDT1
UniProt Synonym Gene Names
MTH1; Nudix motif 1
UniProt Entry Name
8ODP_HUMAN

NCBI Description

Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. [provided by RefSeq, Jul 2008]

Uniprot Description

NUDT1: Antimutagenic. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP. Belongs to the Nudix hydrolase family. 4 isoforms of the human protein are produced by alternative initiation.

Protein type: Hydrolase; EC 3.6.1.56; EC 3.6.1.55

Chromosomal Location of Human Ortholog: 7p22

Cellular Component: mitochondrion; mitochondrial matrix; cytoplasm; nucleus; cytosol

Molecular Function: GTPase activity; snoRNA binding; m7G(5')pppN diphosphatase activity; ATP diphosphatase activity; metal ion binding; 8-oxo-7,8-dihydroguanine triphosphatase activity

Biological Process: DNA protection; dGTP catabolic process; dATP catabolic process; nucleobase, nucleoside and nucleotide metabolic process; purine nucleotide catabolic process; response to oxidative stress; DNA repair

Research Articles on NUDT1

Similar Products

Product Notes

The NUDT1 nudt1 (Catalog #AAA6387752) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDT1 (7,8-dihydro-8-oxoguanine Triphosphatase, 2-hydroxy-dATP Diphosphatase, 8-oxo-dGTPase, Nucleoside Diphosphate-linked Moiety X Motif 1, Nudix Motif 1, MTH1) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NUDT1 nudt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUDT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.