Western Blot (WB)
(Host: RabbitTarget Name: NTAN1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human NTAN1 Polyclonal Antibody | anti-NTAN1 antibody
NTAN1 Antibody - C-terminal region
Gene Names
NTAN1; PNAA; PNAD
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NTAN1; Polyclonal Antibody; NTAN1 Antibody - C-terminal region; anti-NTAN1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDGLWEKISSPG
Sequence Length
310
Applicable Applications for anti-NTAN1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NTAN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NTAN1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NTAN1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NTAN1 antibody
The protein encoded by this gene functions in a step-wise process of protein degradation through the N-end rule pathway. This protein acts as a tertiary destabilizing enzyme that deamidates N-terminal L-Asn residues on proteins to produce N-terminal L-Asp. L-Asp substrates are subsequently conjugated to L-Arg, which is recognized by specific E3 ubiquitin ligases and targeted to the proteasome. Pseudogenes of this gene are located on the long arms of chromosomes 8, 10 and 12. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Product Categories/Family for anti-NTAN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
protein N-terminal asparagine amidohydrolase isoform 2
NCBI Official Synonym Full Names
N-terminal asparagine amidase
NCBI Official Symbol
NTAN1
NCBI Official Synonym Symbols
PNAA; PNAD
NCBI Protein Information
protein N-terminal asparagine amidohydrolase
UniProt Protein Name
Protein N-terminal asparagine amidohydrolase
Protein Family
UniProt Gene Name
NTAN1
UniProt Synonym Gene Names
PNAA; PNAD; Protein N-terminal Asn amidase; Protein N-terminal asparagine amidase; Protein NTN-amidase
UniProt Entry Name
NTAN1_HUMAN
NCBI Description
The protein encoded by this gene functions in a step-wise process of protein degradation through the N-end rule pathway. This protein acts as a tertiary destabilizing enzyme that deamidates N-terminal L-Asn residues on proteins to produce N-terminal L-Asp. L-Asp substrates are subsequently conjugated to L-Arg, which is recognized by specific E3 ubiquitin ligases and targeted to the proteasome. Pseudogenes of this gene are located on the long arms of chromosomes 8, 10 and 12. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]
Research Articles on NTAN1
1. Results indicate that hNTAN1 is highly selective for the hydrolysis of N-terminal peptidyl L-Asn.
Similar Products
Product Notes
The NTAN1 ntan1 (Catalog #AAA3222055) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NTAN1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NTAN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NTAN1 ntan1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPPHFVEHIR STLMFLKKHP SPAHTLFSGN KALLYKKNED GLWEKISSPG. It is sometimes possible for the material contained within the vial of "NTAN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
