Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NR4A1 expression in transfected 293T cell line by NR4A1 polyclonal antibody. Lane 1: NR4A1 transfected lysate (64.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NR4A1 Polyclonal Antibody | anti-NR4A1 antibody

NR4A1 (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1) (PE)

Gene Names
NR4A1; HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NR4A1; Polyclonal Antibody; NR4A1 (Nuclear Receptor Subfamily 4 Group A Member 1; Orphan Nuclear Receptor TR3; Orphan Nuclear Receptor HMR; Early Response Protein NAK1; Testicular Receptor 3; ST-59; Nur77; GFRP1; HMR; NAK1) (PE); anti-NR4A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NR4A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NR4A1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NR4A1, aa1-598 (NP_002126.2).
Immunogen Sequence
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NR4A1 expression in transfected 293T cell line by NR4A1 polyclonal antibody. Lane 1: NR4A1 transfected lysate (64.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NR4A1 expression in transfected 293T cell line by NR4A1 polyclonal antibody. Lane 1: NR4A1 transfected lysate (64.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between NR4A1 and RPS6KA5 HeLa cells were stained with NR4A1 rabbit purified polyclonal 1:1200 and RPS6KA5 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between NR4A1 and RPS6KA5 HeLa cells were stained with NR4A1 rabbit purified polyclonal 1:1200 and RPS6KA5 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-NR4A1 antibody
NR4A1 is a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis.
Product Categories/Family for anti-NR4A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
nuclear receptor subfamily 4, group A, member 1
NCBI Official Symbol
NR4A1
NCBI Official Synonym Symbols
HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77
NCBI Protein Information
nuclear receptor subfamily 4 group A member 1; ST-59; TR3 orphan receptor; early response protein NAK1; growth factor-inducible nuclear protein N10; hormone receptor; nerve growth factor IB nuclear receptor variant 1; nuclear hormone receptor NUR/77; orph

NCBI Description

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

Research Articles on NR4A1

Similar Products

Product Notes

The NR4A1 (Catalog #AAA6387501) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR4A1 (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NR4A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NR4A1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NR4A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.