Mouse anti-Human PITX2 Monoclonal Antibody | anti-PITX2 antibody

PITX2 (Pituitary Homeobox 2, Paired-like Homeodomain Transcription Factor 2, Homeobox Protein PITX2, RIEG Bicoid-related Homeobox Transcription Factor, Solurshin, ALL1-responsive Protein ARP1, PITX2, ARP1, RGS, RIEG, RIEG1) (HRP)

Cat. Num. AAA6154187

• Gene Names: PITX2; RS; RGS; ARP1; Brx1; IDG2; IGDS; IHG2; PTX2; RIEG; IGDS2; IRID2; Otlx2; RIEG1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PITX2; Monoclonal Antibody; PITX2 (Pituitary Homeobox 2; Paired-like Homeodomain Transcription Factor 2; Homeobox Protein PITX2; RIEG Bicoid-related Homeobox Transcription Factor; Solurshin; ALL1-responsive Protein ARP1; ARP1; RGS; RIEG; RIEG1) (HRP); anti-PITX2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G6
• Specificity: Recognizes human PITX2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PITX2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-325 from human PITX2 (AAH13998) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (61.38kD).)

Testing Data

(mmunofluorescence of monoclonal antibody to PITX2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PITX2 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-PITX2 antibody

Pilx2 is a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. This protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. It plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this protein are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development.

Product Categories/Family for anti-PITX2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 40225927
• NCBI GeneID: 5308
• Molecular Weight: 30,336 Da
• NCBI Official Full Name: Homo sapiens paired-like homeodomain 2, mRNA
• NCBI Official Synonym Full Names: paired like homeodomain 2
• NCBI Official Symbol: PITX2
• NCBI Official Synonym Symbols: RS; RGS; ARP1; Brx1; IDG2; IGDS; IHG2; PTX2; RIEG; IGDS2; IRID2; Otlx2; RIEG1
• NCBI Protein Information: pituitary homeobox 2
• Protein Family: Pituitary homeobox

NCBI Description

This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]