Rabbit anti-Human NR2F2 Polyclonal Antibody | anti-NR2F2 antibody

NR2F2 (COUP Transcription Factor 2, COUP-TF2, Apolipoprotein A-I Regulatory Protein 1, ARP-1, COUP Transcription Factor II, COUP-TF II, Nuclear Receptor Subfamily 2 Group F Member 2, ARP1, TFCOUP2) APC

Cat. Num. AAA6387470

• Gene Names: NR2F2; ARP1; CHTD4; NF-E3; NR2F1; SVP40; COUPTFB; TFCOUP2; COUPTFII
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NR2F2; Polyclonal Antibody; NR2F2 (COUP Transcription Factor 2; COUP-TF2; Apolipoprotein A-I Regulatory Protein 1; ARP-1; COUP Transcription Factor II; COUP-TF II; Nuclear Receptor Subfamily 2 Group F Member 2; ARP1; TFCOUP2) APC; anti-NR2F2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NR2F2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-NR2F2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NR2F2, aa1-414 (NP_066285.1).
• Immunogen Sequence: MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NR2F2 expression in transfected 293T cell line by NR2F2 polyclonal antibody. Lane 1: NR2F2 transfected lysate (45.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NR2F2 antibody

COUP-TFII, a NR2 Hepatocyte NF4-Like receptor, has been shown to affect neuronal development and differentiation, homeostasis in various Human tissues, mesenchymal-epithelial interactions during organogenesis, and the development of the cardiovascular system. COUP-TFII interacts with and modulates several nuclear receptors, including estrogen receptor alpha (ER alpha), thyroid hormone receptors (TR), PPAR alpha, and retinoic acid receptors (RAR). Mice lacking COUP-TFII show abnormal heart and vascular development. COUP-TFII expression has been documented in Human adrenal, lung, kidney, liver, spleen, skeletal muscle, and breast. ESTs have been isolated from Human tissue libraries, including cancerous adrenal, bladder, brain, breast, colon, head/neck, kidney, lung, ovary, pancreas, pituitary, prostate, skeletal muscle, skin, smooth muscle, stomach, synovium, and uterus, and normal brain, adipose, adrenal, blood, brain, breast, cervix, ear, embryo, gallbladder, ganglion, heart, kidney, liver/spleen, lung, ovary, placenta, prostate, skin, spleen, testis, uterus, and vessel.

Product Categories/Family for anti-NR2F2 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 14149746
• NCBI GeneID: 7026
• NCBI Accession #: NP_066285.1
• NCBI GenBank Nucleotide #: NM_021005.2
• UniProt Accession #: P24468; Q03754; Q3KQR7; B4DQJ2; B6ZGU1
• Molecular Weight: 29,163 Da
• NCBI Official Full Name: COUP transcription factor 2 isoform a
• NCBI Official Synonym Full Names: nuclear receptor subfamily 2, group F, member 2
• NCBI Official Symbol: NR2F2
• NCBI Official Synonym Symbols: ARP1; CHTD4; NF-E3; NR2F1; SVP40; COUPTFB; TFCOUP2; COUPTFII
• NCBI Protein Information: COUP transcription factor 2; COUP transcription factor II; apolipoprotein AI regulatory protein 1; apolipoprotein A-I regulatory protein 1; ADP-ribosylation factor related protein 1; chicken ovalbumin upstream promoter transcription factor 2; chicken oval
• UniProt Protein Name: COUP transcription factor 2
• Protein Family: COUP transcription factor
• UniProt Gene Name: NR2F2
• UniProt Synonym Gene Names: ARP1; TFCOUP2; COUP-TF2; ARP-1; COUP-TF II
• UniProt Entry Name: COT2_HUMAN

NCBI Description

This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

NR2F2: Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone (in vitro). Regulation of the apolipoprotein A-I gene transcription. Binds to DNA site A. Interacts with SQSTM1. Binds DNA as a dimer; homodimer or heterodimer with NR2F6. Interacts with NCOA1, NCOA2, NCOA3 and PPARGC1A. Interacts with ZFPM2. Ubiquitous. Belongs to the nuclear hormone receptor family. NR2 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Nuclear receptor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 15q26

Cellular Component: nucleus

Molecular Function: ligand-dependent nuclear receptor activity; protein binding; protein homodimerization activity; retinoic acid binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; transcription corepressor activity; transcription factor activity

Biological Process: limb development; skeletal muscle development; intracellular receptor-mediated signaling pathway; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; neuron migration; negative regulation of cyclin-dependent protein kinase activity; negative regulation of transcription from RNA polymerase II promoter; signal transduction; response to estradiol stimulus; anterior/posterior pattern formation; regulation of transcription from RNA polymerase II promoter; fertilization; forebrain development; negative regulation of endothelial cell proliferation; blood vessel morphogenesis; steroid hormone mediated signaling; lipid metabolic process; negative regulation of transcription, DNA-dependent; radial pattern formation; maternal placenta development

Disease: Congenital Heart Defects, Multiple Types, 4