Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IDE AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIDE is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit IDE Polyclonal Antibody | anti-IDE antibody

IDE antibody - N-terminal region

Gene Names
IDE; INSULYSIN
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IDE; Polyclonal Antibody; IDE antibody - N-terminal region; anti-IDE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSN
Sequence Length
1019
Applicable Applications for anti-IDE antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IDE AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIDE is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Western Blot (WB) (WB Suggested Anti-IDE AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIDE is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
Related Product Information for anti-IDE antibody
This is a rabbit polyclonal antibody against IDE. It was validated on Western Blot

Target Description: This gene encodes a zinc metallopeptidase that degrades intracellular insulin, and thereby terminates insulins activity, as well as participating in intercellular peptide signalling by degrading diverse peptides such as glucagon, amylin, bradykinin, and kallidin. The preferential affinity of this enzyme for insulin results in insulin-mediated inhibition of the degradation of other peptides such as beta-amyloid. Deficiencies in this protein's function are associated with Alzheimer's disease and type 2 diabetes mellitus but mutations in this gene have not been shown to be causitive for these diseases. This protein localizes primarily to the cytoplasm but in some cell types localizes to the extracellular space, cell membrane, peroxisome, and mitochondrion.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
118kDa
NCBI Official Full Name
insulin-degrading enzyme isoform 1
NCBI Official Synonym Full Names
insulin degrading enzyme
NCBI Official Symbol
IDE
NCBI Official Synonym Symbols
INSULYSIN
NCBI Protein Information
insulin-degrading enzyme
UniProt Protein Name
Insulin-degrading enzyme
Protein Family
UniProt Gene Name
IDE
UniProt Synonym Gene Names
Insulinase
UniProt Entry Name
IDE_HUMAN

NCBI Description

This gene encodes a zinc metallopeptidase that degrades intracellular insulin, and thereby terminates insulins activity, as well as participating in intercellular peptide signalling by degrading diverse peptides such as glucagon, amylin, bradykinin, and kallidin. The preferential affinity of this enzyme for insulin results in insulin-mediated inhibition of the degradation of other peptides such as beta-amyloid. Deficiencies in this protein's function are associated with Alzheimer's disease and type 2 diabetes mellitus but mutations in this gene have not been shown to be causitive for these diseases. This protein localizes primarily to the cytoplasm but in some cell types localizes to the extracellular space, cell membrane, peroxisome, and mitochondrion. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described but have not been experimentally verified.[provided by RefSeq, Sep 2009]

Uniprot Description

IDE: Plays a role in the cellular breakdown of insulin, IAPP, glucagon, bradykinin, kallidin and other peptides, and thereby plays a role in intercellular peptide signaling. Degrades amyloid formed by APP and IAPP. May play a role in the degradation and clearance of naturally secreted amyloid beta-protein by neurons and microglia. Belongs to the peptidase M16 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Nuclear receptor co-regulator; Cell surface; EC 3.4.24.56

Chromosomal Location of Human Ortholog: 10q23-q25

Cellular Component: nucleoplasm; peroxisomal matrix; extracellular space; cell surface; mitochondrion; cytoplasm; plasma membrane; peroxisome; cytosol; nucleus

Molecular Function: ubiquitin binding; protein homodimerization activity; zinc ion binding; beta-amyloid binding; metalloendopeptidase activity; ATPase activity; peptide binding; beta-endorphin binding; insulin binding; protein binding; glycoprotein binding; ATP binding; receptor binding

Biological Process: negative regulation of proteolysis; positive regulation of protein oligomerization; proteolysis involved in cellular protein catabolic process; viral reproduction; protein heterooligomerization; beta-amyloid metabolic process; insulin receptor signaling pathway; hormone catabolic process; determination of adult life span; proteolysis; protein homooligomerization; protein homotetramerization

Research Articles on IDE

Similar Products

Product Notes

The IDE ide (Catalog #AAA3200273) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IDE antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's IDE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IDE ide for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDVHIGSLSD PPNIAGLSHF CEHMLFLGTK KYPKENEYSQ FLSEHAGSSN. It is sometimes possible for the material contained within the vial of "IDE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.